Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T50699
(Former ID: TTDI02198)
|
|||||
Target Name |
Lymphotoxin beta receptor (LTBR)
|
|||||
Synonyms |
Tumor necrosis factor receptor type III; Tumor necrosis factor receptor superfamily member 3; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor C receptor; TNFRSF3; TNFR3; TNFR-III; TNFCR; TNF-RIII; Lymphotoxin-beta receptor; D12S370
|
|||||
Gene Name |
LTBR
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Rheumatoid arthritis [ICD-11: FA20] | |||||
2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs. Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT.
Click to Show/Hide
|
|||||
BioChemical Class |
Cytokine receptor
|
|||||
UniProt ID | ||||||
Sequence |
MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCS
RCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKR KTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLL ATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGN IYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA TPSNRGPRNQFITHD Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | Baminercept | Drug Info | Phase 2 | Rheumatoid arthritis | [1] | |
2 | HCBE-11 | Drug Info | Phase 1 | Solid tumour/cancer | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Antagonist | [+] 1 Antagonist drugs | + | ||||
1 | Baminercept | Drug Info | [1] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 6 KEGG Pathways | + | ||||
1 | Cytokine-cytokine receptor interaction | |||||
2 | NF-kappa B signaling pathway | |||||
3 | HIF-1 signaling pathway | |||||
4 | Intestinal immune network for IgA production | |||||
5 | HTLV-I infection | |||||
6 | Viral carcinogenesis | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | TNFR2 non-canonical NF-kB pathway | |||||
2 | TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | ClinicalTrials.gov (NCT01552681) Baminercept in Sj ren's Syndrome. U.S. National Institutes of Health. | |||||
REF 2 | ClinicalTrials.gov (NCT00105170) Safety and Tolerability of hCBE-11 in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
REF 3 | Lymphotoxin beta receptor activation on macrophages induces cross-tolerance to TLR4 and TLR9 ligands. J Immunol. 2012 Apr 1;188(7):3426-33. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.