Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T51425
(Former ID: TTDNC00385)
|
|||||
Target Name |
Vascular endothelial growth factor C (VEGFC)
|
|||||
Synonyms |
Vascular endothelial growth factor-related protein; VRP; VEGF-C; Flt4-L; Flt4 ligand
|
|||||
Gene Name |
VEGFC
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Retinopathy [ICD-11: 9B71] | |||||
2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors. Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels.
Click to Show/Hide
|
|||||
BioChemical Class |
Growth factor
|
|||||
UniProt ID | ||||||
Sequence |
MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQL
RSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILK SIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSY LSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAAN KTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCAC ECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T93W1J |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | OPT-302 | Drug Info | Phase 2 | Diabetic macular edema | [2] | |
2 | VGX-100 | Drug Info | Phase 1 | Solid tumour/cancer | [3] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | OPT-302 | Drug Info | [4] | |||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | VGX-100 | Drug Info | [1] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 7 KEGG Pathways | + | ||||
1 | Ras signaling pathway | |||||
2 | Rap1 signaling pathway | |||||
3 | Cytokine-cytokine receptor interaction | |||||
4 | PI3K-Akt signaling pathway | |||||
5 | Focal adhesion | |||||
6 | TNF signaling pathway | |||||
7 | Pathways in cancer | |||||
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | TSH Signaling Pathway | |||||
PID Pathway | [+] 3 PID Pathways | + | ||||
1 | Alpha9 beta1 integrin signaling events | |||||
2 | VEGF and VEGFR signaling network | |||||
3 | VEGFR3 signaling in lymphatic endothelium | |||||
Reactome | [+] 3 Reactome Pathways | + | ||||
1 | Platelet degranulation | |||||
2 | VEGF ligand-receptor interactions | |||||
3 | VEGF binds to VEGFR leading to receptor dimerization | |||||
WikiPathways | [+] 3 WikiPathways | + | ||||
1 | Focal Adhesion | |||||
2 | Signaling by VEGF | |||||
3 | Heart Development |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | National Cancer Institute Drug Dictionary (drug id 724066). | |||||
REF 2 | ClinicalTrials.gov (NCT03345082) A Dose Ranging Study of OPT-302 With Ranibizumab in Neovascular (Wet) AMD. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT01514123) Study of VGX-100 Administered Alone and Co-administered With Bevacizumab in Adult Subjects With Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
REF 4 | Clinical pipeline report, company report or official report of Opthea. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.