Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T51671
(Former ID: TTDR00777)
|
|||||
| Target Name |
Neuropeptide Y (NPY)
|
|||||
| Synonyms |
Pro-neuropeptide Y
|
|||||
| Gene Name |
NPY
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| ADReCS ID | BADD_A01671 ; BADD_A02137 ; BADD_A03103 ; BADD_A04410 ; BADD_A04648 ; BADD_A06327 | |||||
| HIT2.0 ID | T53YWQ | |||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating Transcription Factors | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
| 1 | cAMP signaling pathway | |||||
| 2 | Adipocytokine signaling pathway | |||||
| 3 | Alcoholism | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | Peptide ligand-binding receptors | |||||
| 2 | G alpha (i) signalling events | |||||
| WikiPathways | [+] 3 WikiPathways | + | ||||
| 1 | Endothelin Pathways | |||||
| 2 | GPCR ligand binding | |||||
| 3 | GPCR downstream signaling | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.