Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T55244
(Former ID: TTDI00168)
|
|||||
Target Name |
Gamma-Histone H2AX (H2AFX)
|
|||||
Synonyms |
Phosphorylation of H2AX; Histone H2AX; Histone H2A.x; H2a/x; H2AX
|
|||||
Gene Name |
H2AFX
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation. Variant histone H2A which replaces conventional H2A in a subset of nucleosomes.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPSGGKKATQASQEY Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T88IXL |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Evaluating Gamma-H2AX Expression as a Biomarker of DNA Damage after X-ray in Angiography Patients. J Biomed Phys Eng. 2018 Dec 1;8(4):393-402. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.