Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T55860
(Former ID: TTDI02194)
|
|||||
Target Name |
TAX transcriptionally-activated glycoprotein 1 (OX40)
|
|||||
Synonyms |
Tumor necrosis factor ligand superfamily member 4; TNFSF4; OX40L; Glycoprotein Gp34; CD252
|
|||||
Gene Name |
TNFSF4
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Breast cancer [ICD-11: 2C60-2C6Y] | |||||
2 | General pain disorder [ICD-11: 8E43] | |||||
Function |
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Click to Show/Hide
|
|||||
BioChemical Class |
Cytokine: tumor necrosis factor
|
|||||
UniProt ID | ||||||
Sequence |
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ
SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF CVL Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
1 | AMG 386 | Drug Info | Phase 3 | Neuropathic pain | [2] | |
2 | RG7888 | Drug Info | Phase 2 | Solid tumour/cancer | [3] | |
3 | MEDI6383 | Drug Info | Phase 1 | Solid tumour/cancer | [4] | |
4 | mRNA-2416 | Drug Info | Phase 1 | Lymphoma | [5] | |
5 | mRNA-2752 | Drug Info | Phase 1 | Solid tumour/cancer | [6] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | AMG 386 | Drug Info | [1] | |||
Replacement | [+] 2 Replacement drugs | + | ||||
1 | mRNA-2416 | Drug Info | [9] | |||
2 | mRNA-2752 | Drug Info | [10] |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
1 | Cytokine-cytokine receptor interaction | |||||
NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
1 | TGF_beta_Receptor Signaling Pathway | |||||
2 | TSLP Signaling Pathway | |||||
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | TNFs bind their physiological receptors | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | Vitamin D Receptor Pathway | |||||
2 | TSLP Signaling Pathway |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Clinical targeting of the TNF and TNFR superfamilies.Nat Rev Drug Discov.2013 Feb;12(2):147-68. | |||||
REF 2 | Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. | |||||
REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041453) | |||||
REF 5 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 6 | ClinicalTrials.gov (NCT03739931) Dose Escalation Study of mRNA-2752 for Intratumoral Injection to Participants With Advanced Malignancies. U.S. National Institutes of Health. | |||||
REF 7 | Anti-tumor efficacy and biomarker evaluation of agonistic anti-OX40 antibodies in preclinical models. J Immunother Cancer. 2014; 2(Suppl 3): P105. | |||||
REF 8 | J Clin Oncol 33, 2015 (suppl; abstr 3056). | |||||
REF 9 | Clinical pipeline report, company report or official report of Moderna Therapeutics. | |||||
REF 10 | Clinical pipeline report, company report or official report of Moderna Therapeutics. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.