Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T59486
(Former ID: TTDNR00641)
|
|||||
Target Name |
AN1-type zinc finger protein 5 (ZFAND5)
|
|||||
Synonyms |
Zinc finger protein 216; Zinc finger A20 domain-containing protein 2; ZNF216; ZA20D2
|
|||||
Gene Name |
ZFAND5
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation. Involved in protein degradation via the ubiquitin-proteasome system.
Click to Show/Hide
|
|||||
BioChemical Class |
Zinc-finger
|
|||||
UniProt ID | ||||||
Sequence |
MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPT
SDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVS EPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRY SDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Effects of an Encapsulated Fruit and Vegetable Juice Concentrate on Obesity-Induced Systemic Inflammation: A Randomised Controlled Trial. Nutrients. 2017 Feb 8;9(2). pii: E116. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.