Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T63083
(Former ID: TTDR00922)
|
|||||
Target Name |
DNA repair protein RAD51 homolog 1 (RAD51)
|
|||||
Synonyms |
hRAD51; RECA; RAD51A; RAD51 homolog A; HsRAD51
|
|||||
Gene Name |
RAD51
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | B-cell lymphoma [ICD-11: 2A86] | |||||
2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination (HR). Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3. Also involved in interstrand cross-link repair.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T82S9G |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | CYT-0851 | Drug Info | Phase 1/2 | Solid tumour/cancer | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 2 Inhibitor drugs | + | ||||
1 | CYT-0851 | Drug Info | [3] | |||
2 | AMP-PNP | Drug Info | [1] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 4 KEGG Pathways | + | ||||
1 | Homologous recombination | |||||
2 | Fanconi anemia pathway | |||||
3 | Pathways in cancer | |||||
4 | Pancreatic cancer | |||||
PID Pathway | [+] 3 PID Pathways | + | ||||
1 | p73 transcription factor network | |||||
2 | ATR signaling pathway | |||||
3 | BARD1 signaling events | |||||
Reactome | [+] 4 Reactome Pathways | + | ||||
1 | HDR through Single Strand Annealing (SSA) | |||||
2 | HDR through Homologous Recombination (HRR) | |||||
3 | Presynaptic phase of homologous DNA pairing and strand exchange | |||||
4 | Meiotic recombination | |||||
WikiPathways | [+] 8 WikiPathways | + | ||||
1 | DNA Damage Response | |||||
2 | Meiotic Recombination | |||||
3 | ATM Signaling Pathway | |||||
4 | Integrated Pancreatic Cancer Pathway | |||||
5 | Integrated Breast Cancer Pathway | |||||
6 | Homologous recombination | |||||
7 | Double-Strand Break Repair | |||||
8 | miRNA Regulation of DNA Damage Response |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
REF 2 | ClinicalTrials.gov (NCT03997968) A Phase 1/2 Study of CYT-0851, an Oral RAD51 Inhibitor, in B-Cell Malignancies and Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
REF 3 | National Cancer Institute Drug Dictionary (drug name CYT0851). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.