Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T63598
(Former ID: TTDI01884)
|
|||||
| Target Name |
Pediculus humanus Nicotinic acetylcholine receptor (Pedhc nAChR)
|
|||||
| Synonyms |
Acetylcholine receptor protein alpha 1, 2, 3, 4invertebrate, putative; Acetylcholine receptor protein alpha 1, 2, 3, 4 invertebrate, putative
Click to Show/Hide
|
|||||
| Gene Name |
Pedhc nAChR
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Pediculosis [ICD-11: 1G00] | |||||
| Function |
Mediates the fast actions ofacetylcholine (ACh) in the nervous system and at neuromuscular junctions.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MCLCLCLTPFLDIPGFKPVQMEANPDAKRLYDDLLSNYNRLIRPVVNNTETLTVRLGLKL
SQLIEVNLKSQVMTTNVWVEQKWTDYKLRWNPEEYGGVEMLYVPSEHIWLPDIVLYNNAD GNYEVTLMTKATLNYNGEVYWKPPAIYKSSCEINVLYFPFDEQSCYMKFGSWTYHGYQVD LKHMDQKPGTNLVPVGVDLKEFYLSVEWDILEVPARKNEEYYPCCAEPYSDITFNLKMRR KTLFYTVNLIIPCVGITFLTVLVFYLPSDSGEKVTLTVSILLSLTVFFLLLAEIIPPTSL AVPLLGKYLLFTMMLVTLSIFITVCVLNIYFRSPSTHKMSPWVRNVFLNFIPRLLMMRRP PYSVRRDGYDDSGDNGYASALDYRDGIGEPFPPELKGSPEFESVTTVCKSTFGTESDDNL GTTFRHAQPSDSENIIPRNLSSDVLSALQGVCFIAQHIRNADKDNEVIEDWKYVSMVLDR FFLWVFTLACIGGTCAIIFQAPSLYDQRIPIDQEISLIQFGKIFLNIPREQNSD Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Spinosad | Drug Info | Approved | Head and body lice | [1], [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Spinosad | Drug Info | [1], [2] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4. | |||||
| REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.