Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T63803
(Former ID: TTDR01251)
|
|||||
Target Name |
Vascular endothelial growth factor D (VEGFD)
|
|||||
Synonyms |
c-Fos-induced growth factor; VEGFD; VEGF-D; FIGF
|
|||||
Gene Name |
VEGFD
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Retinopathy [ICD-11: 9B71] | |||||
Function |
Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formationof the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.
Click to Show/Hide
|
|||||
BioChemical Class |
Growth factor
|
|||||
UniProt ID | ||||||
Sequence |
MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | OPT-302 | Drug Info | Phase 2 | Diabetic macular edema | [2] | |
Discontinued Drug(s) | [+] 2 Discontinued Drugs | + | ||||
1 | EG-011 | Drug Info | Discontinued in Phase 1/2 | Angina pectoris | [3] | |
2 | EG-016 | Drug Info | Discontinued in Phase 1/2 | Peripheral vascular disease | [4] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | OPT-302 | Drug Info | [5] | |||
Modulator | [+] 2 Modulator drugs | + | ||||
1 | EG-011 | Drug Info | [1] | |||
2 | EG-016 | Drug Info | [1] |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 6 KEGG Pathways | + | ||||
1 | Ras signaling pathway | |||||
2 | Rap1 signaling pathway | |||||
3 | Cytokine-cytokine receptor interaction | |||||
4 | PI3K-Akt signaling pathway | |||||
5 | Focal adhesion | |||||
6 | Pathways in cancer | |||||
PID Pathway | [+] 3 PID Pathways | + | ||||
1 | Alpha9 beta1 integrin signaling events | |||||
2 | VEGF and VEGFR signaling network | |||||
3 | VEGFR3 signaling in lymphatic endothelium | |||||
Reactome | [+] 3 Reactome Pathways | + | ||||
1 | Platelet degranulation | |||||
2 | VEGF ligand-receptor interactions | |||||
3 | VEGF binds to VEGFR leading to receptor dimerization | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | Focal Adhesion | |||||
2 | Signaling by VEGF |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030807) | |||||
REF 2 | ClinicalTrials.gov (NCT03345082) A Dose Ranging Study of OPT-302 With Ranibizumab in Neovascular (Wet) AMD. U.S. National Institutes of Health. | |||||
REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030807) | |||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031989) | |||||
REF 5 | Clinical pipeline report, company report or official report of Opthea. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.