Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T64137
(Former ID: TTDR00387)
|
|||||
Target Name |
Corticoliberin (CRH)
|
|||||
Synonyms |
Corticotropin-releasing hormone; Corticotropin-releasing factor; Corticotropin releasing hormone; Corticotropin; CRF; Adrenocorticotropic hormone
|
|||||
Gene Name |
CRH
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile. Hormone regulating the release of corticotropin from pituitary gland.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQ
ARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLL LPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQL AQQAHSNRKLMEIIGK Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T05WWN |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating Transcription Factors |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | Long-term depression | |||||
2 | Alcoholism | |||||
Panther Pathway | [+] 1 Panther Pathways | + | ||||
1 | Cortocotropin releasing factor receptor signaling pathway | |||||
PID Pathway | [+] 1 PID Pathways | + | ||||
1 | Rapid glucocorticoid signaling | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Class B/2 (Secretin family receptors) | |||||
2 | G alpha (s) signalling events | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | Myometrial Relaxation and Contraction Pathways | |||||
2 | Corticotropin-releasing hormone | |||||
3 | GPCR ligand binding | |||||
4 | GPCR downstream signaling |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
REF 2 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.