Target Information

Target General Information

Target ID

T68227 (Former ID: TTDR01363)

Target Name

c-Jun messenger RNA (c-Jun mRNA)

Synonyms

V-jun avian sarcoma virus 17 oncogene homolog (mRNA); Transcription factor AP-1 (mRNA); Proto-oncogene c-jun (mRNA); P39 (mRNA); C-jun proto-oncogene (mRNA); Activator protein-1 (mRNA); Activator protein 1 (mRNA); AP1 (mRNA); AP-1 transcription factor (mRNA)

Click to Show/Hide

Gene Name

JUN

Target Type

Literature-reported target

[1]

Function

Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells. Binds to the USP28 promoter in colorectal cancer (CRC) cells. Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'.

Click to Show/Hide

BioChemical Class

mRNA target

UniProt ID

JUN_HUMAN

Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Click to Show/Hide

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Drug Property Profile of Target

Top

(1) Molecular Weight (mw) based Drug Clustering

(2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering

(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering

(4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering

(5) Rotatable Bond Count (rotbonds) based Drug Clustering

(6) Topological Polar Surface Area (polararea) based Drug Clustering

"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five

Target Affiliated Biological Pathways		Top
KEGG Pathway	[+] 34 KEGG Pathways	+
1	MAPK signaling pathway
2	ErbB signaling pathway
3	cAMP signaling pathway
4	Wnt signaling pathway
5	Osteoclast differentiation
6	Focal adhesion
7	Toll-like receptor signaling pathway
8	T cell receptor signaling pathway
9	B cell receptor signaling pathway
10	TNF signaling pathway
11	Neurotrophin signaling pathway
12	GnRH signaling pathway
13	Estrogen signaling pathway
14	Oxytocin signaling pathway
15	Non-alcoholic fatty liver disease (NAFLD)
16	Cocaine addiction
17	Amphetamine addiction
18	Epithelial cell signaling in Helicobacter pylori infection
19	Salmonella infection
20	Pertussis
21	Leishmaniasis
22	Chagas disease (American trypanosomiasis)
23	Hepatitis B
24	Influenza A
25	HTLV-I infection
26	Herpes simplex infection
27	Epstein-Barr virus infection
28	Pathways in cancer
29	Viral carcinogenesis
30	Colorectal cancer
31	Renal cell carcinoma
32	Choline metabolism in cancer
33	Inflammatory bowel disease (IBD)
34	Rheumatoid arthritis
NetPath Pathway	[+] 9 NetPath Pathways	+
1	IL-7 Signaling Pathway
2	IL1 Signaling Pathway
3	TCR Signaling Pathway
4	IL2 Signaling Pathway
5	IL4 Signaling Pathway
6	TSH Signaling Pathway
7	TGF_beta_Receptor Signaling Pathway
8	AndrogenReceptor Signaling Pathway
9	RANKL Signaling Pathway
Panther Pathway	[+] 13 Panther Pathways	+
1	Angiogenesis
2	Apoptosis signaling pathway
3	B cell activation
4	FAS signaling pathway
5	Huntington disease
6	Inflammation mediated by chemokine and cytokine signaling pathway
7	Oxidative stress response
8	PDGF signaling pathway
9	TGF-beta signaling pathway
10	T cell activation
11	Toll receptor signaling pathway
12	Ras Pathway
13	CCKR signaling map ST
Pathwhiz Pathway	[+] 2 Pathwhiz Pathways	+
1	Intracellular Signalling Through Adenosine Receptor A2a and Adenosine
2	Intracellular Signalling Through Adenosine Receptor A2b and Adenosine
PID Pathway	[+] 44 PID Pathways	+
1	Regulation of nuclear SMAD2/3 signaling
2	Fc-epsilon receptor I signaling in mast cells
3	Endothelins
4	BCR signaling pathway
5	RhoA signaling pathway
6	LPA receptor mediated events
7	CD40/CD40L signaling
8	Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met)
9	Calcineurin-regulated NFAT-dependent transcription in lymphocytes
10	Osteopontin-mediated events
11	Validated transcriptional targets of AP1 family members Fra1 and Fra2
12	Presenilin action in Notch and Wnt signaling
13	Integrin-linked kinase signaling
14	CDC42 signaling events
15	Signaling events regulated by Ret tyrosine kinase
16	Regulation of Telomerase
17	IL1-mediated signaling events
18	Glucocorticoid receptor regulatory network
19	IL2-mediated signaling events
20	Direct p53 effectors
21	Regulation of Androgen receptor activity
22	ErbB1 downstream signaling
23	ATF-2 transcription factor network
24	AP-1 transcription factor network
25	ErbB2/ErbB3 signaling events
26	IL6-mediated signaling events
27	PDGFR-beta signaling pathway
28	JNK signaling in the CD4+ TCR pathway
29	Nephrin/Neph1 signaling in the kidney podocyte
30	Validated nuclear estrogen receptor alpha network
31	PDGFR-alpha signaling pathway
32	Regulation of nuclear beta catenin signaling and target gene transcription
33	Signaling mediated by p38-alpha and p38-beta
34	Calcium signaling in the CD4+ TCR pathway
35	HIF-1-alpha transcription factor network
36	S1P2 pathway
37	Downstream signaling in na&#xef
38
39	FGF signaling pathway
40	RAC1 signaling pathway
41	Regulation of retinoblastoma protein
42	Signaling events mediated by focal adhesion kinase
43	FOXA1 transcription factor network
44	IL12 signaling mediated by STAT4
Reactome	[+] 6 Reactome Pathways	+
1	Pre-NOTCH Transcription and Translation
2	Oxidative Stress Induced Senescence
3	Senescence-Associated Secretory Phenotype (SASP)
4	FCERI mediated MAPK activation
5	Activation of the AP-1 family of transcription factors
6	MAPK6/MAPK4 signaling
WikiPathways	[+] 47 WikiPathways	+
1	Toll-like receptor signaling pathway
2	DNA Damage Response (only ATM dependent)
3	SIDS Susceptibility Pathways
4	TCR Signaling Pathway
5	ErbB Signaling Pathway
6	Senescence and Autophagy in Cancer
7	TGF Beta Signaling Pathway
8	IL-2 Signaling Pathway
9	Insulin Signaling
10	EGF/EGFR Signaling Pathway
11	Wnt Signaling Pathway
12	MAPK Cascade
13	Wnt Signaling Pathway and Pluripotency
14	MAPK Signaling Pathway
15	TGF beta Signaling Pathway
16	Copper homeostasis
17	FAS pathway and Stress induction of HSP regulation
18	Signaling of Hepatocyte Growth Factor Receptor
19	Myometrial Relaxation and Contraction Pathways
20	Aryl Hydrocarbon Receptor Pathway
21	IL-3 Signaling Pathway
22	Hair Follicle Development: Cytodifferentiation (Part 3 of 3)
23	Selenium Metabolism and Selenoproteins
24	Pre-NOTCH Expression and Processing
25	Fc epsilon receptor (FCERI) signaling
26	Polycystic Kidney Disease Pathway
27	Apoptosis
28	PDGF Pathway
29	ATM Signaling Pathway
30	Quercetin and Nf-kB/ AP-1 Induced Cell Apoptosis
31	BDNF signaling pathway
32	Integrated Pancreatic Cancer Pathway
33	AGE/RAGE pathway
34	TNF alpha Signaling Pathway
35	B Cell Receptor Signaling Pathway
36	Prostate Cancer
37	Arylhydrocarbon receptor (AhR) signaling pathway
38	TWEAK Signaling Pathway
39	RANKL/RANK Signaling Pathway
40	Integrated Breast Cancer Pathway
41	IL-1 signaling pathway
42	MAPK targets/ Nuclear events mediated by MAP kinases
43	Apoptosis Modulation and Signaling
44	Physiological and Pathological Hypertrophy of the Heart
45	Regulation of toll-like receptor signaling pathway
46	Androgen receptor signaling pathway
47	IL-5 Signaling Pathway

Target-Related Models and Studies

Top

Target Validation

Target Validation Info

References

Top

REF 1

US patent application no. 6,312,900, Antisense oligonucleotide compositions and methods for the modulation of activating protein 1.

REF 2

Structure-activity studies of phenanthroindolizidine alkaloids as potential antitumor agents. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4338-42.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN