Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T68517
(Former ID: TTDNR00685)
|
|||||
| Target Name |
Heat shock protein 27 (HSP27)
|
|||||
| Synonyms |
Protein 3; HspB3; Heat shock protein beta3; Heat shock 17 kDa protein; HSP 17
|
|||||
| Gene Name |
HSPB3
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 5 Target-related Diseases | + | ||||
| 1 | Bladder cancer [ICD-11: 2C94] | |||||
| 2 | Breast cancer [ICD-11: 2C60-2C6Y] | |||||
| 3 | Lung cancer [ICD-11: 2C25] | |||||
| 4 | Ovarian cancer [ICD-11: 2C73] | |||||
| 5 | Prostate cancer [ICD-11: 2C82] | |||||
| Function |
Inhibitor of actin polymerization.
Click to Show/Hide
|
|||||
| BioChemical Class |
Heat shock protein
|
|||||
| UniProt ID | ||||||
| Sequence |
MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAA
ETPPREGKSHFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKL PDGVEIKDLSAVLCHDGILVVEVKDPVGTK Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | OGX-427 | Drug Info | Phase 2 | Lung cancer | [2] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | NK-1001 | Drug Info | Discontinued in Phase 2 | Atrial fibrillation | [3] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 2 Modulator drugs | + | ||||
| 1 | OGX-427 | Drug Info | [1] | |||
| 2 | NK-1001 | Drug Info | [4] | |||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
| REF 2 | ClinicalTrials.gov (NCT02423590) Study of Gemcitabine/Carboplatin First-line Chemotherapy +/- Apatorsen in Advanced Squamous Cell Lung Cancers. U.S. National Institutes of Health. | |||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033456) | |||||
| REF 4 | Novel therapeutic targets in the management of atrial fibrillation. Am J Cardiovasc Drugs. 2014 Dec;14(6):403-21. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.