Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T68887
(Former ID: TTDI01778)
|
|||||
Target Name |
Bombesin receptor (BS)
|
|||||
Synonyms |
BB
Click to Show/Hide
|
|||||
Gene Name |
NMBR; GRPR; BRS3
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Breast cancer [ICD-11: 2C60-2C6Y] | |||||
2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Bombesin receptor activity. G protein-coupled receptor activity. Receptor for neuromedin-B. G protein-coupled receptor signaling pathway. Phospholipase C-activating G protein-coupled receptor signaling pathway.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLG
NIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIP VIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAV FSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLI KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSL GHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAV RMTSLKSNAKNMVTNSVLLNGHSMKQEMAL Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | BAY-86-7548 | Drug Info | Phase 1 | Solid tumour/cancer | [2] | |
2 | Demobesin | Drug Info | Phase 1 | Breast cancer | [3] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Enhancer | [+] 1 Enhancer drugs | + | ||||
1 | BAY-86-7548 | Drug Info | [4] | |||
Antagonist | [+] 7 Antagonist drugs | + | ||||
1 | Demobesin | Drug Info | [1] | |||
2 | bantag-1 | Drug Info | [6] | |||
3 | kuwanon H | Drug Info | [8] | |||
4 | ML-18 | Drug Info | [10] | |||
5 | PD 165929 | Drug Info | [1] | |||
6 | PD 168368 | Drug Info | [12] | |||
7 | PD 176252 | Drug Info | [12] | |||
Agonist | [+] 13 Agonist drugs | + | ||||
1 | bag-1 | Drug Info | [5] | |||
2 | bombesin | Drug Info | [7] | |||
3 | MK-5046 | Drug Info | [9] | |||
4 | neuromedin B | Drug Info | [11] | |||
5 | phenylacetyl-Ala,DTrp-phenthylamide | Drug Info | [13] | |||
6 | PMID12723954C21b | Drug Info | [14] | |||
7 | PMID20167483C22e | Drug Info | [15] | |||
8 | PMID24412111C9f | Drug Info | [16] | |||
9 | PMID24412111C9g | Drug Info | [16] | |||
10 | PMID24900283C8a | Drug Info | [17] | |||
11 | PMID25497965C17c | Drug Info | [18] | |||
12 | ranatensin | Drug Info | [19] | |||
13 | [3H]bag-2 | Drug Info | [5] | |||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | [(N4-Bzdig)0]BB(7-14) | Drug Info | [20] |
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
1 | Neuroactive ligand-receptor interaction | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Peptide ligand-binding receptors | |||||
2 | G alpha (q) signalling events | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | GPCRs, Class A Rhodopsin-like | |||||
2 | Peptide GPCRs |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 38). | |||||
REF 2 | ClinicalTrials.gov (NCT01205321) PET/CT Imaging for Radiation Dosimetry, Plasma Pharmacokinetics, Biodistribution, Safety and Tolerability and Diagnostic Performance of BAY86-7548 in Patients With Prostate Cancer and Healthy Volunteers. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT00989105) Technetium Tc 99m Demobesin-4 for Imaging Procedures in Patients With Prostate Cancer. U.S. National Institutes of Health. | |||||
REF 4 | Plasma pharmacokinetics, whole-body distribution, metabolism, and radiation dosimetry of 68Ga bombesin antagonist BAY 86-7548 in healthy men. J Nucl Med. 2013 Jun;54(6):867-72. | |||||
REF 5 | Regulation of energy homeostasis by bombesin receptor subtype-3: selective receptor agonists for the treatment of obesity. Cell Metab. 2010 Feb 3;11(2):101-12. | |||||
REF 6 | Comparative pharmacology of bombesin receptor subtype-3, nonpeptide agonist MK-5046, a universal peptide agonist, and peptide antagonist Bantag-1 for human bombesin receptors. J Pharmacol Exp Ther. 2013 Oct;347(1):100-16. | |||||
REF 7 | Expression and characterization of cloned human bombesin receptors. Mol Pharmacol. 1995 Jan;47(1):10-20. | |||||
REF 8 | Non-peptide bombesin receptor antagonists, kuwanon G and H, isolated from mulberry. Biochem Biophys Res Commun. 1995 Aug 15;213(2):594-9. | |||||
REF 9 | Antiobesity effect of MK-5046, a novel bombesin receptor subtype-3 agonist. J Pharmacol Exp Ther. 2011 Feb;336(2):356-64. | |||||
REF 10 | ML-18 is a non-peptide bombesin receptor subtype-3 antagonist which inhibits lung cancer growth. Peptides. 2015 Feb;64:55-61. | |||||
REF 11 | Insights into bombesin receptors and ligands: Highlighting recent advances. Peptides. 2015 Oct;72:128-44. | |||||
REF 12 | Characterization of putative GRP- and NMB-receptor antagonist's interaction with human receptors. Peptides. 2009 Aug;30(8):1473-86. | |||||
REF 13 | Pharmacology of putative selective hBRS-3 receptor agonists for human bombesin receptors (BnR): affinities, potencies and selectivity in multiple native and BnR transfected cells. Peptides. 2010 Aug;31(8):1569-78. | |||||
REF 14 | Design of selective peptidomimetic agonists for the human orphan receptor BRS-3. J Med Chem. 2003 May 8;46(10):1918-30. | |||||
REF 15 | Discovery of substituted biphenyl imidazoles as potent, bioavailable bombesin receptor subtype-3 agonists. Bioorg Med Chem Lett. 2010 Mar 15;20(6):1913-7. | |||||
REF 16 | Discovery of novel chiral diazepines as bombesin receptor subtype-3 (BRS-3) agonists with low brain penetration. Bioorg Med Chem Lett. 2014 Feb 1;24(3):750-5. | |||||
REF 17 | Discovery of benzodiazepine sulfonamide-based bombesin receptor subtype 3 agonists and their unusual chirality. ACS Med Chem Lett. 2011 Oct 3;2(12):933-7. | |||||
REF 18 | Synthesis and biological evaluation of novel chiral diazepine derivatives as bombesin receptor subtype-3 (BRS-3) agonists incorporating an antedrug approach. Bioorg Med Chem. 2015 Jan 1;23(1):89-104. | |||||
REF 19 | Pharmacology and cell biology of the bombesin receptor subtype 4 (BB4-R). Biochemistry. 1999 Jun 1;38(22):7307-20. | |||||
REF 20 | Potent bombesin-like peptides for GRP-receptor targeting of tumors with 99mTc: a preclinical study. J Med Chem. 2005 Jan 13;48(1):100-10. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.