Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T72881
(Former ID: TTDR00232)
|
|||||
Target Name |
Leukotriene C4 synthase (LTC4S)
|
|||||
Synonyms |
Leukotriene-C(4)Leukotriene C4 synthase synthase; Leukotriene-C(4) synthase; LTC4 synthase
|
|||||
Gene Name |
LTC4S
|
|||||
Target Type |
Patented-recorded target
|
[1] | ||||
Function |
Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4.
Click to Show/Hide
|
|||||
BioChemical Class |
Carbon-sulfur lyase
|
|||||
UniProt ID | ||||||
EC Number |
EC 4.4.1.20
|
|||||
Sequence |
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA LAALGLLAHFLPAALRAALLGRLRTLLPWA Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T42P8F |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating Transcription Factors | ||||||
Target-interacting Proteins |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Leukotriene C4 synthase: a candidate gene for the aspirin-intolerant asthmatic phenotype. Allergy Asthma Proc. 1999 Nov-Dec;20(6):353-60. | |||||
REF 2 | COMPOUNDS AND USES. US20160326143. | |||||
REF 3 | Compounds and uses. US9657001. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.