Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T74002
(Former ID: TTDR00322)
|
|||||
| Target Name |
Granulocyte-macrophage colony-stimulating factor (CSF2)
|
|||||
| Synonyms |
Sargramostim; Molgramostin; GM-CSF; Colony-stimulating factor; CSF2; CSF
|
|||||
| Gene Name |
CSF2
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Melanoma [ICD-11: 2C30] | |||||
| Function |
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
Click to Show/Hide
|
|||||
| BioChemical Class |
Growth factor
|
|||||
| UniProt ID | ||||||
| Sequence |
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF ESFKENLKDFLLVIPFDCWEPVQE Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| ADReCS ID | BADD_A03633 ; BADD_A04013 ; BADD_A06316 | |||||
| HIT2.0 ID | T27U96 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Talimogene Laherparepvec | Drug Info | Approved | Melanoma | [2] | |
| Clinical Trial Drug(s) | [+] 12 Clinical Trial Drugs | + | ||||
| 1 | JX-594 | Drug Info | Phase 3 | Hepatocellular carcinoma | [3], [4], [5] | |
| 2 | Cabiralizumab | Drug Info | Phase 2 | Solid tumour/cancer | [4], [3] | |
| 3 | GSK3196165 | Drug Info | Phase 2 | Rheumatoid arthritis | [6] | |
| 4 | KB-003 | Drug Info | Phase 2 | Severe asthma | [7] | |
| 5 | KB002/003 | Drug Info | Phase 2 | Rheumatoid arthritis | [8] | |
| 6 | Lenzilumab | Drug Info | Phase 2 | Coronavirus Disease 2019 (COVID-19) | [9] | |
| 7 | Mavrilimumab | Drug Info | Phase 2 | Rheumatoid arthritis | [10], [11] | |
| 8 | MT203 | Drug Info | Phase 2 | Plaque psoriasis | [12], [13] | |
| 9 | Autologous melanoma cell vaccine | Drug Info | Phase 1 | Solid tumour/cancer | [14] | |
| 10 | CDNA vaccine | Drug Info | Phase 1 | Prostate cancer | [15] | |
| 11 | CGTG-102 | Drug Info | Phase 1 | Solid tumour/cancer | [16] | |
| 12 | MORAb-022 | Drug Info | Phase 1 | Autoimmune diabetes | [17] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | RPK-739 | Drug Info | Terminated | Solid tumour/cancer | [18] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 9 Modulator drugs | + | ||||
| 1 | Talimogene Laherparepvec | Drug Info | [1] | |||
| 2 | JX-594 | Drug Info | [19] | |||
| 3 | KB002/003 | Drug Info | [21] | |||
| 4 | MT203 | Drug Info | [22] | |||
| 5 | Autologous melanoma cell vaccine | Drug Info | [21] | |||
| 6 | CDNA vaccine | Drug Info | [21] | |||
| 7 | CGTG-102 | Drug Info | [23] | |||
| 8 | RPK-739 | Drug Info | [1] | |||
| 9 | human monoclonal antibodies (GM-CSF) | Drug Info | [25] | |||
| Antagonist | [+] 3 Antagonist drugs | + | ||||
| 1 | Cabiralizumab | Drug Info | [4] | |||
| 2 | Lenzilumab | Drug Info | [4] | |||
| 3 | Mavrilimumab | Drug Info | [6] | |||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
| REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 4 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 5 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 6 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 7 | ClinicalTrials.gov (NCT00995449) Study of KB003 In Biologics-Inadequate Rheumatoid Arthritis. U.S. National Institutes of Health. | |||||
| REF 8 | Clinical pipeline report, company report or official report of KaloBios Pharmaceuticals. | |||||
| REF 9 | ClinicalTrials.gov (NCT04583969) ACTIV-5 / Big Effect Trial (BET-B) for the Treatment of COVID-19. U.S. National Institutes of Health. | |||||
| REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7785). | |||||
| REF 11 | Clinical pipeline report, company report or official report of MedImmune (2011). | |||||
| REF 12 | ClinicalTrials.gov (NCT02393378) Namilumab vs Adalimumab in Participants With Moderate to Severe Early Rheumatoid Arthritis Inadequately Responding to Methotrexate. U.S. National Institutes of Health. | |||||
| REF 13 | ClinicalTrials.gov (NCT02129777) Efficacy and Safety of Namilumab (MT203) for Plaque Psoriasis | |||||
| REF 14 | Clinical pipeline report, company report or official report of Dana-Farber Cancer Institute Inc. | |||||
| REF 15 | Clinical pipeline report, company report or official report of MannKind Corporation. | |||||
| REF 16 | ClinicalTrials.gov (NCT01437280) GOAT; Phase I Open Label Study of CGTG-102, a GM-CSF Encoding Oncolytic Adenovirus, for Advanced Cancers. U.S. National Institutes of Health. | |||||
| REF 17 | ClinicalTrials.gov (NCT01357759) Safety and Tolerability of MORAb-022 in Healthy and Rheumatoid Arthritis Subjects. U.S. National Institutes of Health. | |||||
| REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024125) | |||||
| REF 19 | Systemic armed oncolytic and immunologic therapy for cancer with JX-594, a targeted poxvirus expressing GM-CSF. Mol Ther. 2006 Sep;14(3):361-70. | |||||
| REF 20 | US patent application no. 2010,0158,905, Combination therapy of arthritis with tranilast. | |||||
| REF 21 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
| REF 22 | GM-CSF as a target in inflammatory/autoimmune disease: current evidence and future therapeutic potential. Expert Rev Clin Immunol. 2015 Apr;11(4):457-65. | |||||
| REF 23 | Serotype chimeric oncolytic adenovirus coding for GM-CSF for treatment of sarcoma in rodents and humans. Int J Cancer. 2014 Aug 1;135(3):720-30. | |||||
| REF 24 | Clinical pipeline report, company report or official report of Morphotek. | |||||
| REF 25 | The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.