Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T78173
|
|||||
| Target Name |
Candida Squalene epoxidase (Candi ERG1)
|
|||||
| Synonyms |
Candi Squalene monooxygenase; Candi Squalene epoxidase; Candi SE
Click to Show/Hide
|
|||||
| Gene Name |
Candi ERG1
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Dermatophytosis [ICD-11: 1F28] | |||||
| 2 | Fungal infection [ICD-11: 1F29-1F2F] | |||||
| Function |
Catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, and is considered to be a rate-limiting enzyme in steroid biosynthesis.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MSSVKYDAIIIGAGVIGPTIATAFARQGRKVLIVERDWSKPDRIVGELMQPAGIKALREL
GMIKAINNIRAVDCTGYYIKYYDETITIPYPLKKDACITNPVKPVPDAVDGVNDKLDSDS TLNVDDWDFDERVRGAAFHHGDFLMNLRQICRDEPNVTAVEATVTKILRDPSDPNTVIGV QTKQPSGTVDYHAKLTISCDGIYSKFRKELSPTNVPTIGSYFIGLYLKNAELPAKGKGHV LLGGHAPALIYSVSPTETRVLCVYVSSKPPSAANDAVYKYLRDNILPAIPKETVPAFKEA LEERKFRIMPNQYLSAMKQGSENHKGFILLGDSLNMRHPLTGGGMTVGLNDSVLLAKLLH PKFVEDFDDHQLIAKRLKTFHRKRKNLDAVINTLSISLYSLFAADKKPLRILRNGCFKYF QRGGECVNGPIGLLSGMLPFPMLLFNHFFSVAFYSVYLNFIERGLLGFPLALFEAFEVLF TAIVIFTPYLWNEIVR Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
| 1 | Butenafine | Drug Info | Approved | Dermatologic infection | [2] | |
| 2 | Terbinafine | Drug Info | Approved | Fungal infection | [3] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 2 Modulator drugs | + | ||||
| 1 | Butenafine | Drug Info | [1] | |||
| 2 | Terbinafine | Drug Info | [1] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Drug Resistance Mutation (DRM) | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
| REF 2 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
| REF 3 | Safety and tolerability of oral antifungal agents in the treatment of fungal nail disease: a proven reality. Ther Clin Risk Manag. 2005 Dec;1(4):299-306. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.