Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T84671
(Former ID: TTDR00999)
|
|||||
| Target Name |
T-cell leukemia/lymphoma protein 1A (TCL1A)
|
|||||
| Synonyms |
TCL1 oncogene; TCL1; TCL-1 protein; T-cell leukemia/lymphoma 1 oncogene; Protein p14 TCL1; P14 TCL1 protein; Oncogene TCL1; Oncogene TCL-1
|
|||||
| Gene Name |
TCL1A
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGR
PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | TCL1: a new drug target in lymphoid and germ-cell malignancies Int J Biochem Cell Biol. 2003 Dec;35(12):1614-8. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.