Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T85554
(Former ID: TTDNC00484)
|
|||||
| Target Name |
T-cell activation antigen CD27 (CD27)
|
|||||
| Synonyms |
Tumor necrosis factor receptor superfamily member 7; Tcell activation antigen CD27; TNFRSF7; T14; CD27L receptor; CD27 antigen
|
|||||
| Gene Name |
CD27
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 8 Target-related Diseases | + | ||||
| 1 | Brain cancer [ICD-11: 2A00] | |||||
| 2 | Colorectal cancer [ICD-11: 2B91] | |||||
| 3 | Head and neck cancer [ICD-11: 2D42] | |||||
| 4 | Ovarian cancer [ICD-11: 2C73] | |||||
| 5 | Renal cell carcinoma [ICD-11: 2C90] | |||||
| 6 | Leukaemia [ICD-11: 2A60-2B33] | |||||
| 7 | Lymphoma [ICD-11: 2A80-2A86] | |||||
| 8 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
May play a role in survival of activated T-cells. May play a role in apoptosis through association with SIVA1. Receptor for CD70/CD27L.
Click to Show/Hide
|
|||||
| BioChemical Class |
Cytokine receptor
|
|||||
| UniProt ID | ||||||
| Sequence |
MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAA
QCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPP QRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCHYSCPREE EGSTIPIQEDYRKPEPACSP Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
| 1 | Varlilumab | Drug Info | Phase 2 | Colorectal cancer | [2] | |
| 2 | CDX-1127 | Drug Info | Phase 1 | Solid tumour/cancer | [3] | |
| 3 | CDX-527 | Drug Info | Phase 1 | Solid tumour/cancer | [4] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | Varlilumab | Drug Info | [1], [5] | |||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | CDX-1127 | Drug Info | [6] | |||
| Activator | [+] 1 Activator drugs | + | ||||
| 1 | CDX-527 | Drug Info | [7] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-interacting Proteins | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Cytokine-cytokine receptor interaction | |||||
| NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
| 1 | IL2 Signaling Pathway | |||||
| 2 | IL4 Signaling Pathway | |||||
| Reactome | [+] 1 Reactome Pathways | + | ||||
| 1 | TNFs bind their physiological receptors | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 3 | ClinicalTrials.gov (NCT02284971) Pilot Study of SBRT and CDX-1127 in Prostate Cancer. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT04440943) A Study of the PD-L1xCD27 Bispecific Antibody CDX-527 in Patients With Advanced Malignancies. U.S. National Institutes of Health. | |||||
| REF 5 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 6 | Clinical pipeline report, company report or official report of Celldex Therapeutics. | |||||
| REF 7 | Development of CDX-527: a bispecific antibody combining PD-1 blockade and CD27 costimulation for cancer immunotherapy. Cancer Immunol Immunother. 2020 Oct;69(10):2125-2137. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.