Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T87350
(Former ID: TTDI02317)
|
|||||
| Target Name |
Platelet-derived growth factor B (PDGFB)
|
|||||
| Synonyms |
SIS; Protooncogene cSis; Proto-oncogene c-Sis; Plateletderived growth factor subunit B; Plateletderived growth factor beta polypeptide; Plateletderived growth factor B chain; Platelet-derived growth factor subunit B; Platelet-derived growth factor beta polypeptide; Platelet-derived growth factor B chain; PDGF2; PDGF-2; PDGF subunit B; Becaplermin
|
|||||
| Gene Name |
PDGFB
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Diabetic foot ulcer [ICD-11: BD54] | |||||
| Function |
Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA. Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis.
Click to Show/Hide
|
|||||
| BioChemical Class |
Growth factor
|
|||||
| UniProt ID | ||||||
| Sequence |
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG A Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T89S77 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 4 Clinical Trial Drugs | + | ||||
| 1 | PDGF-BB | Drug Info | Phase 3 | Diabetic foot ulcer | [2], [3] | |
| 2 | E-10030 | Drug Info | Phase 2 | Macular degeneration | [4] | |
| 3 | GAM-501 | Drug Info | Phase 2 | Diabetic foot ulcer | [5] | |
| 4 | CR-002 | Drug Info | Phase 1 | Cystic fibrosis | [6] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 3 Modulator drugs | + | ||||
| 1 | PDGF-BB | Drug Info | [1] | |||
| 2 | GAM-501 | Drug Info | [8] | |||
| 3 | CR-002 | Drug Info | [9] | |||
| Antagonist | [+] 1 Antagonist drugs | + | ||||
| 1 | E-10030 | Drug Info | [4], [7] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-regulating Transcription Factors | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of Adocia. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5039). | |||||
| REF 3 | ClinicalTrials.gov (NCT02236793) A Phase 3 Clinical Trial to Assess the Effectiveness of BioChaperone PDGF-BB In the Treatment of Chronic Diabetic Foot Ulcer. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT01089517) A Safety and Efficacy Study of E10030 (Anti-PDGF Pegylated Aptamer) Plus Lucentis for Neovascular Age-Related Macular Degeneration. U.S. National Institutes of Health. | |||||
| REF 5 | ClinicalTrials.gov (NCT00493051) Phase 2b Study of GAM501 in the Treatment of Diabetic Ulcers of the Lower Extremities. U.S. National Institutes of Health. | |||||
| REF 6 | ClinicalTrials.gov (NCT01347190) Safety and Tolerability Study of Liquid Alpha1 Proteinase Inhibitor (API) in Subjects With Cystic Fibrosis. U.S. National Institutes of Health. | |||||
| REF 7 | Aptamers as therapeutics. Nat Rev Drug Discov. 2010 Jul;9(7):537-50. | |||||
| REF 8 | Treatment of nonhealing diabetic foot ulcers with a platelet-derived growth factor gene-activated matrix (GAM501): results of a phase 1/2 trial. Wound Repair Regen. 2009 Nov-Dec;17(6):772-9. | |||||
| REF 9 | A phase I study of CR002, a fully-human monoclonal antibody against platelet-derived growth factor-D. Int J Clin Pharmacol Ther. 2008 May;46(5):236-44. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.