Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T88023
(Former ID: TTDR00192)
|
|||||
| Target Name |
Lymphocyte activation antigen CD30 (TNFRSF8)
|
|||||
| Synonyms |
Tumor necrosis factor receptor superfamily member 8; KI-1 antigen; D1S166E; CD30L receptor; CD30
|
|||||
| Gene Name |
TNFRSF8
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Hodgkin lymphoma [ICD-11: 2B30] | |||||
| Function |
May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B. Receptor for TNFSF8/CD30L.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Brentuximab vedotin | Drug Info | Approved | Hodgkin lymphoma | [2], [3], [4] | |
| Clinical Trial Drug(s) | [+] 19 Clinical Trial Drugs | + | ||||
| 1 | AFM13 | Drug Info | Phase 2 | Hodgkin lymphoma | [5] | |
| 2 | CAR-T cells targeting CD30 | Drug Info | Phase 2 | Non-hodgkin lymphoma | [6] | |
| 3 | Iratumumab | Drug Info | Phase 2 | Lymphoma | [7] | |
| 4 | SGN-30 | Drug Info | Phase 2 | Solid tumour/cancer | [8] | |
| 5 | 4SCAR19 and 4SCAR30 | Drug Info | Phase 1/2 | B-cell lymphoma | [9] | |
| 6 | Anti-CD30 CAR T cells | Drug Info | Phase 1/2 | Lymphoma | [10] | |
| 7 | Anti-CD30-CAR-transduced T cells | Drug Info | Phase 1/2 | leukaemia | [11] | |
| 8 | CAR-T cells targeting CD30 | Drug Info | Phase 1/2 | leukaemia | [12] | |
| 9 | CAR.CD30 cells | Drug Info | Phase 1/2 | Immune System disease | [13], [14] | |
| 10 | CART30 | Drug Info | Phase 1/2 | Non-hodgkin lymphoma | [15] | |
| 11 | Anti-CD30 CAR-T cells | Drug Info | Phase 1 | leukaemia | [16] | |
| 12 | Anti-CD30-CAR T cells | Drug Info | Phase 1 | Hodgkin lymphoma | [17] | |
| 13 | ATLCAR.CD30 cells | Drug Info | Phase 1 | Immune System disease | [18] | |
| 14 | ATLCAR.CD30.CCR4 cells | Drug Info | Phase 1 | Immune System disease | [18] | |
| 15 | CAR CD30 T cells | Drug Info | Phase 1 | Non-hodgkin lymphoma | [19] | |
| 16 | CD30 CAR T Cells | Drug Info | Phase 1 | Non-hodgkin lymphoma | [20] | |
| 17 | ICAR30 T cells | Drug Info | Phase 1 | Anaplastic large cell lymphoma | [21] | |
| 18 | SGN-CD30C | Drug Info | Phase 1 | Lymphoma | [22] | |
| 19 | Xmab-2513 | Drug Info | Phase 1 | Lymphoma | [23] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Modulator | [+] 2 Modulator drugs | + | ||||
| 1 | Brentuximab vedotin | Drug Info | [1] | |||
| 2 | VT-362 | Drug Info | [30] | |||
| CAR-T-Cell-Therapy | [+] 12 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | CAR-T cells targeting CD30 | Drug Info | [6] | |||
| 2 | Anti-CD30 CAR T cells | Drug Info | [10] | |||
| 3 | Anti-CD30-CAR-transduced T cells | Drug Info | [11] | |||
| 4 | CAR-T cells targeting CD30 | Drug Info | [12] | |||
| 5 | CAR.CD30 cells | Drug Info | [13], [14] | |||
| 6 | CART30 | Drug Info | [15] | |||
| 7 | Anti-CD30 CAR-T cells | Drug Info | [16] | |||
| 8 | Anti-CD30-CAR T cells | Drug Info | [17] | |||
| 9 | ATLCAR.CD30 cells | Drug Info | [18] | |||
| 10 | CAR CD30 T cells | Drug Info | [19] | |||
| 11 | CD30 CAR T Cells | Drug Info | [20] | |||
| 12 | ICAR30 T cells | Drug Info | [21] | |||
| CAR-T-Cell-Therapy(Dual specific) | [+] 2 CAR-T-Cell-Therapy(Dual specific) drugs | + | ||||
| 1 | 4SCAR19 and 4SCAR30 | Drug Info | [9] | |||
| 2 | ATLCAR.CD30.CCR4 cells | Drug Info | [18] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-interacting Proteins | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Cytokine-cytokine receptor interaction | |||||
| NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
| 1 | Leptin Signaling Pathway | |||||
| 2 | TCR Signaling Pathway | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6772). | |||||
| REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 4 | ClinicalTrials.gov (NCT01990534) A Study of Brentuximab Vedotin in Patients With Relapsed or Refractory Hodgkin Lymphoma. U.S. National Institutes of Health. | |||||
| REF 5 | ClinicalTrials.gov (NCT02321592) GHSG-AFM13 An Open-label, Multicenter Phase II Trial With AFM13 in Patients With Relapsed or Refractory Hodgkin Lymphoma. U.S. National Institutes of Health. | |||||
| REF 6 | ClinicalTrials.gov (NCT03196830) CAR-T for R/R B-NHL | |||||
| REF 7 | ClinicalTrials.gov (NCT00284804) A Phase II Study of MDX-060 in Subjects With Relapsed or Refractory Hodgkin's Disease. U.S. National Institutes of Health. | |||||
| REF 8 | ClinicalTrials.gov (NCT00099255) Study of SGN-30 (Anti-CD30 mAb) in Patients With Primary Cutaneous Anaplastic Large Cell Lymphoma. U.S. National Institutes of Health. | |||||
| REF 9 | ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies | |||||
| REF 10 | ClinicalTrials.gov (NCT02274584) CAR T Cells Targeting CD30 Positive Lymphomas (4SCAR30273) | |||||
| REF 11 | ClinicalTrials.gov (NCT02958410) A Clinical Research of CD30-Targeted CAR-T in Lymphocyte Malignancies | |||||
| REF 12 | ClinicalTrials.gov (NCT03312205) CAR-T Cells for Relapsed or Refractory Haematopoietic and Lymphoid Malignancies | |||||
| REF 13 | ClinicalTrials.gov (NCT02663297) Administration of T Lymphocytes for Prevention of Relapse of Lymphomas | |||||
| REF 14 | ClinicalTrials.gov (NCT02690545) Study of CD30 CAR for Relapsed/Refractory CD30+ HL and CD30+ NHL | |||||
| REF 15 | ClinicalTrials.gov (NCT02259556) CD30-directed Chimeric Antigen Receptor T (CART30) Therapy in Relapsed and Refractory CD30 Positive Lymphomas | |||||
| REF 16 | ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies | |||||
| REF 17 | ClinicalTrials.gov (NCT03049449) T Cells Expressing a Fully-Human Anti-CD30 Chimeric Antigen Receptor for Treating CD30-Expressing Lymphomas | |||||
| REF 18 | ClinicalTrials.gov (NCT03602157) Study of CAR-T Cells Expressing CD30 and CCR4 for r/r CD30+ HL and NHL | |||||
| REF 19 | ClinicalTrials.gov (NCT01316146) Administration of T Lymphocytes for Hodgkin's Lymphoma and Non-Hodgkin's Lymphoma (CART CD30) | |||||
| REF 20 | ClinicalTrials.gov (NCT02917083) CD30 CAR T Cells, Relapsed CD30 Expressing Lymphoma (RELY-30) | |||||
| REF 21 | ClinicalTrials.gov (NCT03383965) CD30 Targeted CAR-T in Treating CD30-Expressing Lymphomas | |||||
| REF 22 | Clinical pipeline report, company report or official report of Seagen. | |||||
| REF 23 | ClinicalTrials.gov (NCT00606645) Safety Study of XmAb2513 to Treat Hodgkin Lymphoma or Anaplastic Large Cell Lymphoma. U.S. National Institutes of Health. | |||||
| REF 24 | Clinical pipeline report, company report or official report of Affimed Therapeutics. | |||||
| REF 25 | Utilizing CD30 expression as a rational target for therapy of lymphoma. J Hematol Oncol. 2012; 5(Suppl 1): A2. | |||||
| REF 26 | The anti-CD30 monoclonal antibody SGN-30 promotes growth arrest and DNA fragmentation in vitro and affects antitumor activity in models of Hodgkin's disease. Cancer Res. 2002 Jul 1;62(13):3736-42. | |||||
| REF 27 | Phase I study of an anti-CD30 Fc engineered humanized monoclonal antibody in Hodgkin lymphoma (HL) or anaplastic large cell lymphoma (ALCL) patients: Safety, pharmacokinetics (PK), immunogenicity, and efficacy. J Clin Oncol (Meeting Abstracts) May 2009 vol. 27 no. 15S 8531. | |||||
| REF 28 | Antitumor activity of anti-CD30 immunotoxin (Ber-H2/saporin) in vitro and in severe combined immunodeficiency disease mice xenografted with human CD30+ anaplastic large-cell lymphoma. Blood. 1995 Apr15;85(8):2139-46. | |||||
| REF 29 | Phase 1 trial of the novel bispecific molecule H22xKi-4 in patients with refractory Hodgkin lymphoma. Blood. 2002 Nov 1;100(9):3101-7. | |||||
| REF 30 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1877). | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.