Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T93440
(Former ID: TTDS00521)
|
|||||
| Target Name |
Interleukin 6 receptor (IL6R)
|
|||||
| Synonyms |
Membrane glycoprotein; Interleukin-6 receptor; IL-6R; IL-6 receptor
Click to Show/Hide
|
|||||
| Gene Name |
IL6R; IL6ST
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Rheumatoid arthritis [ICD-11: FA20] | |||||
| Function |
Low concentration of a soluble form of IL6 receptor acts as an agonist of IL6 activity.
Click to Show/Hide
|
|||||
| BioChemical Class |
Cytokine receptor
|
|||||
| UniProt ID | ||||||
| Sequence |
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR Click to Show/Hide
|
|||||
| HIT2.0 ID | T98SBW | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
| 1 | Sarilumab | Drug Info | Approved | Rheumatoid arthritis | [2] | |
| 2 | Tocilizumab | Drug Info | Approved | Rheumatoid arthritis | [3], [4] | |
| Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
| 1 | SA-237 | Drug Info | Phase 3 | Rheumatoid arthritis | [5] | |
| 2 | SAR153191 | Drug Info | Phase 3 | Ankylosing spondylitis | [6], [7] | |
| 3 | Sirukumab | Drug Info | Phase 3 | Rheumatoid arthritis | [8], [9] | |
| 4 | ALX-0061 | Drug Info | Phase 2 | Autoimmune diabetes | [10], [11] | |
| 5 | Vobarilizumab | Drug Info | Phase 2 | Rheumatoid arthritis | [12] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | SBP-002 | Drug Info | Terminated | Melanoma | [13] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Modulator | [+] 4 Modulator drugs | + | ||||
| 1 | Sarilumab | Drug Info | [14] | |||
| 2 | Tocilizumab | Drug Info | [1] | |||
| 3 | SBP-002 | Drug Info | [14] | |||
| 4 | FM-101 | Drug Info | [17] | |||
| Antagonist | [+] 3 Antagonist drugs | + | ||||
| 1 | SA-237 | Drug Info | [15] | |||
| 2 | SAR153191 | Drug Info | [16] | |||
| 3 | Sant7 | Drug Info | [21] | |||
| Inhibitor | [+] 2 Inhibitor drugs | + | ||||
| 1 | Vobarilizumab | Drug Info | [19] | |||
| 2 | Alpha-D-Mannose | Drug Info | [20] | |||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 6 KEGG Pathways | + | ||||
| 1 | Cytokine-cytokine receptor interaction | |||||
| 2 | HIF-1 signaling pathway | |||||
| 3 | PI3K-Akt signaling pathway | |||||
| 4 | Jak-STAT signaling pathway | |||||
| 5 | Hematopoietic cell lineage | |||||
| 6 | Non-alcoholic fatty liver disease (NAFLD) | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | MAPK3 (ERK1) activation | |||||
| 2 | MAPK1 (ERK2) activation | |||||
| WikiPathways | [+] 5 WikiPathways | + | ||||
| 1 | SIDS Susceptibility Pathways | |||||
| 2 | Senescence and Autophagy in Cancer | |||||
| 3 | IL-6 signaling pathway | |||||
| 4 | Differentiation Pathway | |||||
| 5 | Interleukin-6 signaling | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5. | |||||
| REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2018 | |||||
| REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6881). | |||||
| REF 4 | Molecular targets of rheumatoid arthritis. Inflamm Allergy Drug Targets. 2008 Mar;7(1):53-66. | |||||
| REF 5 | ClinicalTrials.gov (NCT02073279) Efficacy and Safety Study as Monotherapy of SA237 to Treat NMO and NMOSD. U.S. National Institutes of Health. | |||||
| REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7999). | |||||
| REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027858) | |||||
| REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7989). | |||||
| REF 9 | ClinicalTrials.gov (NCT02531633) Efficacy and Safety Study of Sirukumab in Patients With Giant Cell Arteritis. | |||||
| REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8363). | |||||
| REF 11 | ClinicalTrials.gov (NCT02287922) A Phase IIb Study for ALX-0061 Monotherapy in Subjects With Rheumatoid Arthritis. U.S. National Institutes of Health. | |||||
| REF 12 | ClinicalTrials.gov (NCT02518620) An Open-Label Extension Study Assessing the Long-Term Efficacy and Safety of ALX-0061 in Subjects With Rheumatoid Arthritis. U.S. National Institutes of Health. | |||||
| REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022850) | |||||
| REF 14 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
| REF 15 | IBC's 23rd Annual Antibody Engineering, 10th Annual Antibody Therapeutics International Conferences and the 2012 Annual Meeting of The Antibody Society: December 3-6, 2012, San Diego, CA. MAbs. 2013 March 1; 5(2): 178-201. | |||||
| REF 16 | Pharma & Vaccines. Product Development Pipeline. April 29 2009. | |||||
| REF 17 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2310). | |||||
| REF 18 | The preclinical pharmacology of the high affinity anti-IL-6R Nanobody ALX-0061 supports its clinical development in rheumatoid arthritis. Arthritis Res Ther. 2015 May 20;17:135. | |||||
| REF 19 | Clinical pipeline report, company report or official report of Ablynx. | |||||
| REF 20 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
| REF 21 | Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.