Resistance mutation info of target
| Target General Information | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Target ID | T52617 | |||||||||||||||||
| Target Name | Bacterial 3-oxoacyl-[acyl-carrier-protein] synthase 1 (kasA) | |||||||||||||||||
| Gene Name | kasA | |||||||||||||||||
| Species | Mycobacterium tuberculosis | |||||||||||||||||
| UniProt ID | FAB1_MYCTU | |||||||||||||||||
| Sequence |
MSQPSTANGGFPSVVVTAVTATTSISPDIESTWKGLLAGESGIHALEDEFVTKWDLAVKI GGHLKDPVDSHMGRLDMRRMSYVQRMGKLLGGQLWESAGSPEVDPDRFAVVVGTGLGGAE RIVESYDLMNAGGPRKVSPLAVQMIMPNGAAAVIGLQLGARAGVMTPVSACSSGSEAIAH AWRQIVMGDADVAVCGGVEGPIEALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFG EAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGL SPADIDHVNAHGTATPIGDAAEANAIRVAGCDQAAVYAPKSALGHSIGAVGALESVLTVL TLRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVALAFGRY [My cobacterium tuberculosis] |
|||||||||||||||||
| Drug and Corresponding Resistance Mutations | ||||||||||||||||||
| Mutation Info | Missense: D66N | |||||||||||||||||
| Drugs |
|
|||||||||||||||||
| Mutation Info | Missense: F413L | |||||||||||||||||
| Drugs |
|
|||||||||||||||||
| Mutation Info | Missense: G269S | |||||||||||||||||
| Drugs |
|
|||||||||||||||||
| Mutation Info | Missense: G312S | |||||||||||||||||
| Drugs |
|
|||||||||||||||||
| Mutation Info | Missense: G387D | |||||||||||||||||
| Drugs |
|
|||||||||||||||||
| Mutation Info | Missense: M77I | |||||||||||||||||
| Drugs |
|
|||||||||||||||||
| Mutation Info | Missense: R121K | |||||||||||||||||
| Drugs |
|
|||||||||||||||||
| References | ||||||||||||||||||
| REF 1 | Contribution of kasA analysis to detection of isoniazid-resistant Mycobacterium tuberculosis in Singapore. Antimicrob Agents Chemother. 1999 Aug;43(8):2087-9. | |||||||||||||||||
| REF 2 | Bioinformatics of antimicrobial resistance in the age of molecular epidemiology. Curr Opin Microbiol. 2015 Oct;27:45-50. | |||||||||||||||||
| REF 3 | CARD 2017: expansion and model-centric curation of the comprehensive antibiotic resistance database. Nucleic Acids Res. 2017 Jan 4;45(D1):D566-D573. | |||||||||||||||||
| REF 4 | Inhibition of a Mycobacterium tuberculosis beta-ketoacyl ACP synthase by isoniazid. Science. 1998 Jun 5;280(5369):1607-10. | |||||||||||||||||
| REF 5 | Single nucleotide polymorphisms in genes associated with isoniazid resistance in Mycobacterium tuberculosis. Antimicrob Agents Chemother. 2003 Apr;47(4):1241-50. | |||||||||||||||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.