Drug General Information |
Drug ID |
D09SGV |
Drug Name |
Daclatasvir |
Drug Info
|
Drug Type |
Small molecular drug |
Structure |
|
Drug Resistance Mutations |
Target Name |
HCV Non-structural protein 5A (NS5A) |
Target Info
|
Gene Name |
NS5A |
Uniprot ID |
POLG_HCV1(1973-2420) |
Species |
Hepatitis C virus genotype 1a |
Reference Sequence |
SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYKGVWRVDGIMHTRCHCG AEITGHVKNGTMRIVGPRTCRNMWSGTFPINAYTTGPCTPLPAPNYTFALWRVSAEEYVE IRQVGDFHYVTGMTTDNLKCPCQVPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLH EYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSVASSSASQLSAPSLK ATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREISVPA EILRKSRRFAQALPVWARPDYNPPLVETWKKPDYEPPVVHGCPLPPPKSPPVPPPRKKRT VVLTESTLSTALAELATRSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDAESYSSMPPLE GEPGDPDLSDGSWSTVSSEANAEDVVCC [Hepatitis C virus genotype 1a] |
Targeted Disease |
HCV infection |
Drug Resistance Mutations |
Mutation info |
Missense: L31M |
[555755],
[555761]
|
Level of Resistance |
Confer 3350 fold resistance |
|
Mutation info |
Missense: L31V + Y93H |
[555755],
[555761]
|
Level of Resistance |
Confer 8336 fold resistance |
|
Mutation info |
Missense: L31V |
[555755],
[555761]
|
Level of Resistance |
Confer 233 fold resistance |
|
Mutation info |
Missense: M28T + Q30H |
[555755],
[555761]
|
Level of Resistance |
Confer 8336 fold resistance |
|
Mutation info |
Missense: M28T |
[555755],
[555761]
|
Level of Resistance |
Confer 683 fold resistance |
|
Mutation info |
Missense: P32L |
[555755],
[555761]
|
Level of Resistance |
Confer 1850 fold resistance |
|
Mutation info |
Missense: Q30E |
[555755],
[555761]
|
Level of Resistance |
Confer 24933 fold resistance |
|
Mutation info |
Missense: Q30H |
[555755],
[555761]
|
Level of Resistance |
Confer 1450 fold resistance |
|
Mutation info |
Missense: Q30R |
[555755],
[555761]
|
Level of Resistance |
Confer 1217 fold resistance |
|
Mutation info |
Missense: Y93C |
[555755],
[555761]
|
Level of Resistance |
Confer 5367 fold resistance |
|
Mutation info |
Missense: Y93H |
[555755],
[555761]
|
Level of Resistance |
Confer 47477 fold resistance |
|
Mutation info |
Missense: Y93N |
[555755],
[555761]
|
Level of Resistance |
Confer 103767 fold resistance |
|
References |
Ref 556264 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. |
Ref 555755 | Chemical genetics strategy identifies an HCV NS5A inhibitor with a potent clinical effect. Nature. 2010 May 6;465(7294):96-100. doi: 10.1038/nature08960. Epub 2010 Apr 21. |
Ref 555761 | Resistance analysis of the hepatitis C virus NS5A inhibitor BMS-790052 in an in vitro replicon system. Antimicrob Agents Chemother. 2010 Sep;54(9):3641-50. doi: 10.1128/AAC.00556-10. Epub 2010 Jun 28. |