Drug General Information
Drug ID D09SGV
Drug Name Daclatasvir Drug Info
Drug Type Small molecular drug
Structure D09SGV
Drug Resistance Mutations
Target Name HCV Non-structural protein 5A (NS5A) Target Info
Gene Name NS5A
Uniprot ID POLG_HCV1(1973-2420)
Species Hepatitis C virus genotype 1a
Reference Sequence SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYKGVWRVDGIMHTRCHCG
AEITGHVKNGTMRIVGPRTCRNMWSGTFPINAYTTGPCTPLPAPNYTFALWRVSAEEYVE
IRQVGDFHYVTGMTTDNLKCPCQVPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLH
EYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSVASSSASQLSAPSLK
ATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREISVPA
EILRKSRRFAQALPVWARPDYNPPLVETWKKPDYEPPVVHGCPLPPPKSPPVPPPRKKRT
VVLTESTLSTALAELATRSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDAESYSSMPPLE
GEPGDPDLSDGSWSTVSSEANAEDVVCC [Hepatitis C virus genotype 1a]
Targeted Disease HCV infection
Drug Resistance Mutations
Mutation info Missense: L31M [555755], [555761]
Level of Resistance Confer 3350 fold resistance
Mutation info Missense: L31V + Y93H [555755], [555761]
Level of Resistance Confer 8336 fold resistance
Mutation info Missense: L31V [555755], [555761]
Level of Resistance Confer 233 fold resistance
Mutation info Missense: M28T + Q30H [555755], [555761]
Level of Resistance Confer 8336 fold resistance
Mutation info Missense: M28T [555755], [555761]
Level of Resistance Confer 683 fold resistance
Mutation info Missense: P32L [555755], [555761]
Level of Resistance Confer 1850 fold resistance
Mutation info Missense: Q30E [555755], [555761]
Level of Resistance Confer 24933 fold resistance
Mutation info Missense: Q30H [555755], [555761]
Level of Resistance Confer 1450 fold resistance
Mutation info Missense: Q30R [555755], [555761]
Level of Resistance Confer 1217 fold resistance
Mutation info Missense: Y93C [555755], [555761]
Level of Resistance Confer 5367 fold resistance
Mutation info Missense: Y93H [555755], [555761]
Level of Resistance Confer 47477 fold resistance
Mutation info Missense: Y93N [555755], [555761]
Level of Resistance Confer 103767 fold resistance
References
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 555755Chemical genetics strategy identifies an HCV NS5A inhibitor with a potent clinical effect. Nature. 2010 May 6;465(7294):96-100. doi: 10.1038/nature08960. Epub 2010 Apr 21.
Ref 555761Resistance analysis of the hepatitis C virus NS5A inhibitor BMS-790052 in an in vitro replicon system. Antimicrob Agents Chemother. 2010 Sep;54(9):3641-50. doi: 10.1128/AAC.00556-10. Epub 2010 Jun 28.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.