Resistance mutation info of drug
Drug General Information | ||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Drug ID | D0Y0SW | |||||||||||||||
Drug Name | Flutamide | Drug Info | ||||||||||||||
Synonyms | Apimid; ApoFlutamide; Cebatrol; Chimax; Cytamid; Drogenil; Eulexin; Eulexine; Fluken; Flulem; Flumid; FlutaGRY; Flutacell;Flutamida; Flutamidum; Flutamin; Flutandrona; Flutaplex; Flutexin; Fugerel; METHOXYCHLOR; NFBA; Niftholide; Niftolid; Niftolide; NovoFlutamide; Odyne; Oncosal; Prostacur; Prostandril; Prostica; Prostogenat; Testotard; Alphapharm Brand of Flutamide; Apo Flutamide; Apogepha Brand of Flutamide; Apotex Brand of Flutamide; Azupharma Brand of Flutamide; Cell pharm Brand of Flutamide; Chephasaar Brand of Flutamide; Chiron Brand of Flutamide; Ciclum Brand of Flutamide; Esparma Brand of Flutamide; Essex Brand of Flutamide; Fluta GRY; Fluta cell; Gry Brand of Flutamide; Hexal Brand of Flutamide; InibsaBrand of Flutamide; Ipsen Brand of Flutamide; Juta Brand of Flutamide; Kendrick Brand of Flutamide; Lemery Brand of Flutamide; Novo Flutamide; Novopharm Brand of Flutamide; PMS Flutamide; Pharmascience Brand of Flutamide; Prasfarma Brand of Flutamide; Q Pharm Brand of Flutamide; Schering Brand of Flutamide; Schering Plough Brand of Flutamide; TAD Brand of Flutamide; Tedec Meiji Brand of Flutamide; ETHINYL ESTRADIOL); F 9397; F0663; Fluta 1A Pharma; Flutamide USP25; SCH13521; Sch 13521; Apo-Flutamide; Cebatrol, veterinary; Eulexin (TN); Fluta-GRY; Fluta-cell; Flutamida [INN-Spanish]; Flutamide(pubertal study); Flutamidum [INN-Latin]; NK-601; Novo-Flutamide; PMS-Flutamide; PUBERTAL FLUTAMIDE STUDY (PUBERTAL STUDIES OF VINCLOZOLIN; Q-Pharm Brand of Flutamide; Sch-13521; Schering-Plough Brand of Flutamide; Flutamide [USAN:BAN:INN]; Ham's F-12 medium; Eulexin, Flutamin, Drogenil,Flutamide; Flutamide (JAN/USP/INN); Alpha,alpha,alpha-Trifluoro-2-methyl-4'-nitro-m-propionotoluidide; M-propionotoluidide,alpha,alpha,alpha-trifluoro-2-methyl-4'-nitro; M-Propionotoluidide, alpha,alpha,alpha-trifluoro-2-methyl-4'-nitro-(8CI); 1A Brand of Flutamide; 2-Methyl-N-(4-nitro-3-[trifluoromethyl]phenyl)propanamide; 2-Methyl-N-[4-nitro-3-(trifluoromethyl)phenyl]propanamide; 2-Methyl-N-[4-nitro-3-(trifluoromethyl)phenyl]propionamide; 4'-Nitro-3'-(trifluoromethyl)isobutyranilide; 4'-Nitro-3'-trifluoromethylisobutyramilide; 4'-Nitro-3'-trifluoromethylisobutyranilide; 4-Nitro-3-(trifluoromethyl)isobutyranilide | |||||||||||||||
Drug Type | Small molecular drug | |||||||||||||||
Therapeutic Class | Anticancer Agents | |||||||||||||||
Company | Schering-Plough Corporation | |||||||||||||||
Structure | ||||||||||||||||
Drug Resistance Mutations | ||||||||||||||||
Target Name | Androgen receptor (AR) | Target Info | ||||||||||||||
Gene Name | AR | |||||||||||||||
Uniprot ID | ANDR_HUMAN | |||||||||||||||
Species | Homo sapiens | |||||||||||||||
Reference Sequence | MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII SVQVPKILSGKVKPIYFHTQ [Homo sapiens] |
|||||||||||||||
Targeted Disease | Prostate Cancer | |||||||||||||||
Drug Resistance Mutations |
|
|||||||||||||||
|
||||||||||||||||
|
||||||||||||||||
|
||||||||||||||||
References | ||||||||||||||||
Ref 555520 | Androgen receptor mutations in androgen-independent prostate cancer: Cancer and Leukemia Group B Study 9663. J Clin Oncol. 2003 Jul 15;21(14):2673-8. | |||||||||||||||
Ref 555528 | Constitutive activation of the androgen receptor by a point mutation in the hinge region: a new mechanism for androgen-independent growth in prostate cancer. Int J Cancer. 2004 Jan 1;108(1):152-7. | |||||||||||||||
Ref 555704 | Treatment-dependent androgen receptor mutations in prostate cancer exploit multiple mechanisms to evade therapy. Cancer Res. 2009 May 15;69(10):4434-42. doi: 10.1158/0008-5472.CAN-08-3605. Epub 2009 Apr 14. | |||||||||||||||
Ref 555862 | A mutation in the ligand binding domain of the androgen receptor of human LNCaP cells affects steroid binding characteristics and response to anti-androgens. Biochem Biophys Res Commun. 1990 Dec 14;173(2):534-40. | |||||||||||||||
Ref 556165 | Mutation of the androgen-receptor gene in metastatic androgen-independent prostate cancer. N Engl J Med. 1995 May 25;332(21):1393-8. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.