Resistance mutation info of target
Target General Information | |||||
---|---|---|---|---|---|
Target ID | T39087 | ||||
Target Name | HIV Integrase | Target Info | |||
Species | Human immunodeficiency virus type 1 (HIV-1) | ||||
Uniprot ID | POL_HV1B1(1160-1447) | ||||
Sequence | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAK LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED [Human immu nodeficiency virus type 1 (HIV-1)] |
||||
Drug Resistance Mutation and Corresponding Drugs | |||||
Mutation Info | Missense: E138A | ||||
Mutation Info | Missense: E138A/K/T + G140A/C/S | ||||
Mutation Info | Missense: E138K | ||||
Mutation Info | Missense: E138T | ||||
Mutation Info | Missense: E157Q | ||||
Mutation Info | Missense: E92G | ||||
Mutation Info | Missense: E92Q | ||||
Mutation Info | Missense: E92V | ||||
Mutation Info | Missense: F121Y | ||||
Mutation Info | Missense: G118R | ||||
Mutation Info | Missense: G140A | ||||
Mutation Info | Missense: G140C | ||||
Mutation Info | Missense: G140S | ||||
Mutation Info | Missense: G163K | ||||
Mutation Info | Missense: G163R | ||||
Mutation Info | Missense: H51Y | ||||
Mutation Info | Missense: H51Y + R263K | ||||
Mutation Info | Missense: N155H | ||||
Mutation Info | Missense: N155S | ||||
Mutation Info | Missense: N155T | ||||
Mutation Info | Missense: P145S | ||||
Mutation Info | Missense: Q146P | ||||
Mutation Info | Missense: Q148H | ||||
Mutation Info | Missense: Q148K | ||||
Mutation Info | Missense: Q148N | ||||
Mutation Info | Missense: Q148R | ||||
Mutation Info | Missense: R263K | ||||
Mutation Info | Missense: S147G | ||||
Mutation Info | Missense: S153F | ||||
Mutation Info | Missense: S153Y | ||||
Mutation Info | Missense: S230R | ||||
Mutation Info | Missense: T66A | ||||
Mutation Info | Missense: T66I | ||||
Mutation Info | Missense: T66K | ||||
Mutation Info | Missense: T97A | ||||
Mutation Info | Missense: V151A | ||||
Mutation Info | Missense: V151L | ||||
Mutation Info | Missense: Y143A | ||||
Mutation Info | Missense: Y143C | ||||
Mutation Info | Missense: Y143G | ||||
Mutation Info | Missense: Y143H | ||||
Mutation Info | Missense: Y143K | ||||
Mutation Info | Missense: Y143R | ||||
Mutation Info | Missense: Y143S | ||||
Reference | |||||
Ref 555646 | Broad antiretroviral activity and resistance profile of the novel human immunodeficiency virus integrase inhibitor elvitegravir (JTK-303/GS-9137). J Virol. 2008 Jan;82(2):764-74. Epub 2007 Oct 31. | ||||
Ref 555652 | Mutations associated with failure of raltegravir treatment affect integrase sensitivity to the inhibitor in vitro. Antimicrob Agents Chemother. 2008 Apr;52(4):1351-8. doi: 10.1128/AAC.01228-07. Epub 2008 Jan 28. | ||||
Ref 555674 | Subgroup and resistance analyses of raltegravir for resistant HIV-1 infection. N Engl J Med. 2008 Jul 24;359(4):355-65. doi: 10.1056/NEJMoa0708978. | ||||
Ref 555675 | Drug resistance profiles for the HIV integrase gene in patients failing raltegravir salvage therapy. HIV Med. 2008 Oct;9(9):765-70. doi: 10.1111/j.1468-1293.2008.00628.x. Epub 2008 Jul 21. | ||||
Ref 555736 | Strand transfer inhibitors of HIV-1 integrase: bringing IN a new era of antiretroviral therapy. Antiviral Res. 2010 Jan;85(1):101-18. doi: 10.1016/j.antiviral.2009.11.004. Epub 2009 Nov 17. | ||||
Ref 555746 | Genotypic/phenotypic patterns of HIV-1 integrase resistance to raltegravir. J Antimicrob Chemother. 2010 Mar;65(3):425-33. doi: 10.1093/jac/dkp477. Epub 2010 Jan 7. | ||||
Ref 555752 | Long-term efficacy and safety of the HIV integrase inhibitor raltegravir in patients with limited treatment options in a Phase II study. J Acquir Immune Defic Syndr. 2010 Apr 1;53(4):456-63. | ||||
Ref 555782 | In Vitro antiretroviral properties of S/GSK1349572, a next-generation HIV integrase inhibitor. Antimicrob Agents Chemother. 2011 Feb;55(2):813-21. doi: 10.1128/AAC.01209-10. Epub 2010 Nov 29. | ||||
Ref 555802 | HIV-1 integrase inhibitor resistance and its clinical implications. J Infect Dis. 2011 May 1;203(9):1204-14. doi: 10.1093/infdis/jir025. | ||||
Ref 555823 | Efficacy and safety of once daily elvitegravir versus twice daily raltegravir in treatment-experienced patients with HIV-1 receiving a ritonavir-boosted protease inhibitor: randomised, double-blind, phase 3, non-inferiority study. Lancet Infect Dis. 2012 Jan;12(1):27-35. doi: 10.1016/S1473-3099(11)70249-3. Epub 2011 Oct 18. | ||||
Ref 555833 | In vitro resistance selections using elvitegravir, raltegravir, and two metabolites of elvitegravir M1 and M4. Antiviral Res. 2012 Feb;93(2):288-96. doi: 10.1016/j.antiviral.2011.12.008. Epub 2011 Dec 16. | ||||
Ref 556228 | The HIVdb system for HIV-1 genotypic resistance interpretation. Intervirology. 2012;55(2):98-101. doi: 10.1159/000331998. Epub 2012 Jan 24. | ||||
Ref 555852 | Broad phenotypic cross-resistance to elvitegravir in HIV-infected patients failing on raltegravir-containing regimens. Antimicrob Agents Chemother. 2012 Jun;56(6):2873-8. doi: 10.1128/AAC.06170-11. Epub 2012 Mar 26. | ||||
Ref 555872 | Co-formulated elvitegravir, cobicistat, emtricitabine, and tenofovir disoproxil fumarate versus ritonavir-boosted atazanavir plus co-formulated emtricitabine and tenofovir disoproxil fumarate for initial treatment of HIV-1 infection: a randomised, double-blind, phase 3, non-inferiority trial. Lancet. 2012 Jun 30;379(9835):2429-38. doi: 10.1016/S0140-6736(12)60918-0. | ||||
Ref 555877 | Development of elvitegravir resistance and linkage of integrase inhibitor mutations with protease and reverse transcriptase resistance mutations. PLoS One. 2012;7(7):e40514. doi: 10.1371/journal.pone.0040514. Epub 2012 Jul 18. | ||||
Ref 555922 | Viral fitness cost prevents HIV-1 from evading dolutegravir drug pressure. Retrovirology. 2013 Feb 22;10:22. doi: 10.1186/1742-4690-10-22. | ||||
Ref 556030 | Evolution of a novel pathway leading to dolutegravir resistance in a patient harbouring N155H and multiclass drug resistance. J Antimicrob Chemother. 2015 Feb;70(2):405-11. doi: 10.1093/jac/dku387. Epub 2014 Oct 3. | ||||
Ref 556237 | Evolutionary consequences of drug resistance: shared principles across diverse targets and organisms. Nat Rev Genet. 2015 Aug;16(8):459-71. doi: 10.1038/nrg3922. Epub 2015 Jul 7. | ||||
Ref 556239 | Resistance to direct-acting antiviral agents: clinical utility and significance. Curr Opin HIV AIDS. 2015 Sep;10(5):381-9. doi: 10.1097/COH.0000000000000177. | ||||
Ref 556153 | Infrequent development of drug resistance in HIV-1-infected treatment-naive subjects after 96 weeks of treatment with elvitegravir/cobicistat/emtricitabine/tenofovir alafenamide or elvitegravir/cobicistat/emtricitabine/tenofovir disoproxil fumarate. Antivir Ther. 2017 Jan 11. doi: 10.3851/IMP3125. [Epub ahead of print] |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.