Resistance mutation info of target
Target General Information | |||||
---|---|---|---|---|---|
Target ID | T72657 | ||||
Target Name | Bacterial 30S ribosomal protein S12 (rpsL) | Target Info | |||
Gene Name | rpsL | ||||
Species | Mycobacterium tuberculosis | ||||
Uniprot ID | RS12_MYCTU | ||||
Sequence | MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQ VEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAK KEKG [Mycobacterium tuberculosis] |
||||
Drug Resistance Mutation and Corresponding Drugs | |||||
Mutation Info | Missense: G84V | ||||
Mutation Info | Missense: K43R | ||||
Mutation Info | Missense: K43T | ||||
Mutation Info | Missense: K51N | ||||
Mutation Info | Missense: K88M | ||||
Mutation Info | Missense: K88Q | ||||
Mutation Info | Missense: K88R | ||||
Mutation Info | Missense: K88T | ||||
Mutation Info | Missense: R86P | ||||
Mutation Info | Missense: R86W | ||||
Mutation Info | Missense: R9H | ||||
Mutation Info | Missense: T40I | ||||
Mutation Info | Missense: T41S | ||||
Mutation Info | Missense: V52G | ||||
Mutation Info | Missense: V87L | ||||
Mutation Info | Missense: V93M | ||||
Reference | |||||
Ref 555546 | Molecular characterisation of streptomycin-resistant Mycobacterium tuberculosis strains isolated in Poland. Int J Tuberc Lung Dis. 2004 Aug;8(8):1032-5. | ||||
Ref 555624 | Loss of a conserved 7-methylguanosine modification in 16S rRNA confers low-level streptomycin resistance in bacteria. Mol Microbiol. 2007 Feb;63(4):1096-106. | ||||
Ref 556243 | CARD 2017: expansion and model-centric curation of the comprehensive antibiotic resistance database. Nucleic Acids Res. 2017 Jan 4;45(D1):D566-D573. doi: 10.1093/nar/gkw1004. Epub 2016 Oct 26. | ||||
Ref 556172 | Molecular basis of streptomycin resistance in Mycobacterium tuberculosis: alterations of the ribosomal protein S12 gene and point mutations within a functional 16S ribosomal RNA pseudoknot. Mol Microbiol. 1993 Sep;9(6):1239-46. | ||||
Ref 556174 | The rpsL gene and streptomycin resistance in single and multiple drug-resistant strains of Mycobacterium tuberculosis. Mol Microbiol. 1993 Nov;10(3):521-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.