| Target General Information |
|---|
| Target ID |
T95678 |
| Target Name |
Influenza Proton channel protein (M2) |
Target Info
|
| Gene Name |
M2 |
| Species |
Influenza A viruses H1N1 |
| Uniprot ID |
M2_I35A3 |
| Sequence |
MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLK
RGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE [Influenza A viruses H
1N1] |
| Drug Resistance Mutation and Corresponding Drugs |
|---|
| Mutation Info |
Missense: S31N |
| Drugs |
| Drug Name |
Memantine |
Drug Info |
[1]
|
| Targeted Disease |
Influenza virus infection |
|
| Drug Name |
Amantadine |
Drug Info |
[2],
[3]
|
| Targeted Disease |
Influenza virus infection |
|
| Drug Name |
Oseltamivir |
Drug Info |
[2]
|
| Targeted Disease |
Influenza virus infection |
|
| Reference |
|---|
| REF 1 | Discovery of Potential, Non-Toxic Influenza Virus Inhibitor by Computational Techniques. Mol Inform. 2014 Aug;33(8):559-65. doi: 10.1002/minf.201400041. Epub 2014 Jul 24. |
|---|
| REF 2 | Design and expeditious synthesis of organosilanes as potent antivirals targeting multidrug-resistant influenza A viruses. Eur J Med Chem. 2017 Jul 28;135:70-76. doi: 10.1016/j.ejmech.2017.04.038. Epub 2017 Apr 20. |
|---|
| REF 3 | Investigation of a recent rise of dual amantadine-resistance mutations in the influenza A M2 sequence.BMC Genet.2015;16 Suppl 2:S3. |
|---|
