Target Information

Target General Infomation
Target ID
T76630
Former ID
TTDS00096
Target Name
CAMPATH-1 antigen
Gene Name
CD52
Synonyms
CD52 antigen; CDW52; Cambridge pathology 1 antigen; Epididymal secretory protein E5; CD52
Target Type
Successful
Disease Multiple scierosis; Chronic lymphocytic leukaemia [ICD9:340; ICD10: G35, C91]
Multiple scierosis [ICD9: 340; ICD10: G35]
Function
May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
BioChemical Class
Transmembrane protein
UniProt ID
P31358
Sequence
MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
S
Drugs and Mode of Action
Drug(s) Alemtuzumab Drug Info Approved Multiple scierosis; Chronic lymphocytic leukaemia [532651], [537129], [541850]
GZ402668 Drug Info Phase 1 Multiple scierosis [524983]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
NetPath Pathway IL2 Signaling Pathway
References
Ref 524983ClinicalTrials.gov (NCT02282826) A First-in-human, Single Ascending Dose Study of GZ402668 in Patients With Progressive Multiple Sclerosis. U.S. National Institutes of Health.
Ref 5326512013 FDA drug approvals. Nat Rev Drug Discov. 2014 Feb;13(2):85-9.
Ref 537129New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
Ref 541850(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6770).
Ref 537198Targeted therapy for chronic lymphocytic leukemia. Target Oncol. 2009 Jan;4(1):11-21. Epub 2009 Jan 27.
Ref 537391CD52 expression in peripheral T-cell lymphomas determined by combined immunophenotyping using tumor cell specific T-cell receptor antibodies. Leuk Lymphoma. 2009 Jun;50(6):1010-6.
Ref 537403Clinical evaluation of busulfan, cladribine and alemtuzumab as reduced intensity conditioning for stem cell transplantation. Ann Transplant. 2009 Apr-Jun;14(2):7-12.
Ref 537504Identifying alemtuzumab as an anti-myeloid cell antiangiogenic therapy for the treatment of ovarian cancer. J Transl Med. 2009 Jun 19;7:49.
Ref 551419Characterization of a Next Generation Anti-CD52 Antibody. Neurology. April 6, 2015 vol. 84 no. 14.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.