Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T16340
|
||||
Former ID |
TTDI01935
|
||||
Target Name |
Interleukin-1 alpha ligand
|
||||
Gene Name |
IL1A
|
||||
Synonyms |
Hematopoietin1; IL1 alpha; Interleukin1 alpha; IL1A
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Atherosclerosis [ICD9: 414.0, 440; ICD10: I70] | ||||
Osteoarthritis [ICD9: 715; ICD10: M15-M19, M47] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Unspecified [ICD code not available] | |||||
Function |
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
|
||||
BioChemical Class |
Cytokine: interleukin
|
||||
UniProt ID | |||||
Sequence |
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP NLFIATKQDYWVCLAGGPPSITDFQILENQA |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | MAPK signaling pathway | ||||
Cytokine-cytokine receptor interaction | |||||
Apoptosis | |||||
Osteoclast differentiation | |||||
Hematopoietic cell lineage | |||||
Non-alcoholic fatty liver disease (NAFLD) | |||||
Type I diabetes mellitus | |||||
Prion diseases | |||||
Salmonella infection | |||||
Pertussis | |||||
Leishmaniasis | |||||
Tuberculosis | |||||
Measles | |||||
Influenza A | |||||
Inflammatory bowel disease (IBD) | |||||
Rheumatoid arthritis | |||||
Graft-versus-host disease | |||||
NetPath Pathway | IL5 Signaling Pathway | ||||
IL1 Signaling Pathway | |||||
TCR Signaling Pathway | |||||
PANTHER Pathway | Interleukin signaling pathway | ||||
Pathway Interaction Database | IL1-mediated signaling events | ||||
Validated transcriptional targets of deltaNp63 isoforms | |||||
a6b1 and a6b4 Integrin signaling | |||||
Reactome | Senescence-Associated Secretory Phenotype (SASP) | ||||
Interleukin-1 signaling | |||||
Interleukin-1 processing | |||||
WikiPathways | SIDS Susceptibility Pathways | ||||
TCR Signaling Pathway | |||||
Senescence and Autophagy in Cancer | |||||
Cytokines and Inflammatory Response | |||||
Hypertrophy Model | |||||
MAPK Signaling Pathway | |||||
FAS pathway and Stress induction of HSP regulation | |||||
Hematopoietic Stem Cell Differentiation | |||||
Structural Pathway of Interleukin 1 (IL-1) | |||||
Spinal Cord Injury | |||||
Allograft Rejection | |||||
IL-1 signaling pathway | |||||
Interleukin-1 signaling | |||||
References | |||||
Ref 545177 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002363) | ||||
Ref 548077 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021743) | ||||
Ref 532430 | Inhibition of interleukin-1 release by IX 207-887. Agents Actions. 1990 Jun;30(3-4):350-62. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.