Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T45591
|
||||
Former ID |
TTDI02137
|
||||
Target Name |
Nucleophosmin
|
||||
Gene Name |
NPM1
|
||||
Synonyms |
NPM; Nucleolar phosphoprotein B23; Nucleolar protein NO38; Numatrin; NPM1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Function |
Involved in diverse cellular processes such as ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and regulation of tumor suppressors p53/TP53 and ARF. Binds ribosome presumably to drive ribosome nuclear export. Associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. Acts as a chaperonin for the core histones H3, H2B and H4. Stimulates APEX1 endonuclease activity on apurinic/apyrimidinic (AP) double- stranded DNA but inhibits APEX1 endonuclease activity on AP single-stranded RNA. May exert a control of APEX1 endonuclease activity within nucleoli devoted to repairAP on rDNA and the removal of oxidized rRNA molecules. In concert with BRCA2, regulates centrosome duplication. Regulates centriole duplication: phosphorylation by PLK2 is able to trigger centriole replication. Negatively regulates the activation of EIF2AK2/PKR and suppresses apoptosis through inhibition of EIF2AK2/PKR autophosphorylation. {ECO:0000269|PubMed:12882984, ECO:0000269|PubMed:16107701, ECO:0000269|PubMed:17015463, ECO:0000269|PubMed:18809582, ECO:0000269|PubMed:19188445, ECO:0000269|PubMed:20352051, ECO:0000269|PubMed:21084279, ECO:0000269|PubMed:22002061}.
|
||||
BioChemical Class |
Nucleoplasmin
|
||||
UniProt ID | |||||
Sequence |
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL |
||||
Drugs and Mode of Action | |||||
Modulator | IPP-204106 | Drug Info | |||
Pathways | |||||
Pathway Interaction Database | Aurora B signaling | ||||
Validated targets of C-MYC transcriptional activation | |||||
HIF-1-alpha transcription factor network | |||||
BARD1 signaling events | |||||
WikiPathways | Host Interactions of HIV factors | ||||
Nucleosome assembly | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.