Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T63083
|
||||
Former ID |
TTDR00922
|
||||
Target Name |
DNA repair protein RAD51 homolog 1
|
||||
Gene Name |
RAD51
|
||||
Synonyms |
HRAD51; HsRAD51; RAD51
|
||||
Target Type |
Research
|
||||
Function |
Participates in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA and forms helical nucleoprotein filaments. Part of a PALB2- scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role inDNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3.
|
||||
BioChemical Class |
DNA repair
|
||||
UniProt ID | |||||
Sequence |
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD |
||||
Inhibitor | Phosphoaminophosphonic Acid-Adenylate Ester | Drug Info | [1] | ||
Pathways | |||||
KEGG Pathway | Homologous recombination | ||||
Fanconi anemia pathway | |||||
Pathways in cancer | |||||
Pancreatic cancer | |||||
Pathway Interaction Database | p73 transcription factor network | ||||
ATR signaling pathway | |||||
BARD1 signaling events | |||||
Reactome | HDR through Single Strand Annealing (SSA) | ||||
HDR through Homologous Recombination (HRR) | |||||
Presynaptic phase of homologous DNA pairing and strand exchange | |||||
Meiotic recombination | |||||
WikiPathways | DNA Damage Response | ||||
Meiotic Recombination | |||||
ATM Signaling Pathway | |||||
Integrated Pancreatic Cancer Pathway | |||||
Integrated Breast Cancer Pathway | |||||
Homologous recombination | |||||
Double-Strand Break Repair | |||||
miRNA Regulation of DNA Damage Response | |||||
References | |||||
REF 1 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.