Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T78393
|
||||
Former ID |
TTDR01372
|
||||
Target Name |
mRNA of human Macrophage migration inhibitory factor
|
||||
Gene Name |
MIF
|
||||
Synonyms |
GIF (mRNA); Glycosylationinhibiting factor (mRNA); Ldopachrome isomerase (mRNA); Ldopachrome tautomerase (mRNA); MIF (mRNA); Macrophage migration inhibitory factor (mRNA); Phenylpyruvate tautomerase (mRNA); MIF
|
||||
Target Type |
Research
|
||||
Function |
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti- inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. Itis not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
|
||||
BioChemical Class |
Intramolecular oxidoreductases
|
||||
Target Validation |
T78393
|
||||
UniProt ID | |||||
EC Number |
EC 5.3.3.12
|
||||
Sequence |
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
||||
Inhibitor | 1-(2-chlorophenyl)-3-(pyridin-2-yl)thiourea | Drug Info | [551226] | ||
1-phenyl-3-(1,3,4-thiadiazol-2-yl)thiourea | Drug Info | [551226] | |||
2-(4-hydroxystyryl)quinolin-8-ol | Drug Info | [529867] | |||
3,3,3-tris(4-chlorophenyl)propanoic acid | Drug Info | [527973] | |||
3-(1H-pyrazol-3-yl)benzoic acid | Drug Info | [529867] | |||
3-acetyl-7-hydroxy-2H-chromen-2-one | Drug Info | [529867] | |||
3-benzyl-5-fluorobenzo[d]oxazol-2(3H)-one | Drug Info | [531118] | |||
3-benzyl-5-methylbenzo[d]oxazol-2(3H)-one | Drug Info | [531118] | |||
3-benzyl-6-methylbenzo[d]oxazol-2(3H)-one | Drug Info | [531118] | |||
4-((pyridin-4-ylthio)methyl)benzene-1,2-diol | Drug Info | [527973] | |||
4-(4-benzyl-1H-1,2,3-triazol-1-yl)phenol | Drug Info | [531232] | |||
4-iodo-6-phenylpyrimidine | Drug Info | [531118] | |||
6-phenylpyridazin-3-yl thiophene-2-carboxylate | Drug Info | [551226] | |||
7-hydroxy-3-phenyl-2H-chromen-2-one | Drug Info | [529867] | |||
Benzofuran-2-yl(indolin-1-yl)methanone | Drug Info | [529867] | |||
Ethyl 7-hydroxy-2-oxo-2H-chromene-3-carboxylate | Drug Info | [529867] | |||
N-(2-bromobenzoyloxy)-4-chlorobenzamide | Drug Info | [551226] | |||
S-benzo[d]oxazol-2-yl O-butyl carbonothioate | Drug Info | [551226] | |||
Pathways | |||||
KEGG Pathway | Tyrosine metabolism | ||||
Phenylalanine metabolism | |||||
PathWhiz Pathway | Tyrosine Metabolism | ||||
WikiPathways | Spinal Cord Injury | ||||
Adipogenesis | |||||
References | |||||
Ref 527973 | J Med Chem. 2006 Jan 26;49(2):523-33.Classification of chemical compounds by protein-compound docking for use in designing a focused library. | ||||
Ref 529867 | J Med Chem. 2009 Jan 22;52(2):416-24.Discovery of human macrophage migration inhibitory factor (MIF)-CD74 antagonists via virtual screening. | ||||
Ref 531118 | Bioorg Med Chem Lett. 2010 Oct 1;20(19):5811-4. Epub 2010 Aug 3.Optimization of N-benzyl-benzoxazol-2-ones as receptor antagonists of macrophage migration inhibitory factor (MIF). | ||||
Ref 531232 | Bioorg Med Chem Lett. 2010 Dec 1;20(23):7033-6. Epub 2010 Sep 29.Receptor agonists of macrophage migration inhibitory factor. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.