Target Validation Information | |||||
---|---|---|---|---|---|
Target ID | T78581 | ||||
Target Name | Galanin receptor type 1 | ||||
Target Type | Research |
||||
Drug Potency against Target | GalB2 | Drug Info | Ki = 3.5 nM | [530680] | |
[Sar1Ala]GAL-B2 | Drug Info | Ki = 11 nM | [530680] | ||
[Sar1Gly]GAL-B2 | Drug Info | Ki = 2.8 nM | [530680] | ||
(Sar)WTLNSAGYLLGPKK(Lys-myristoyl)K | Drug Info | Ki = 2.6 nM | [529952] | ||
(Sar)WTLNSAGYLLGPKK(Lys-palmitoyl)K | Drug Info | Ki = 3.5 nM | [529952] | ||
(Sar)WTLNSAGYLLGPKKKK | Drug Info | Ki = 0.4 nM | [529952] | ||
GWTLNSAGYLLGPPPALALA-CONH2 | Drug Info | Ki = 0.1 nM | [530680] | ||
GWTLNSAGYLLGPRHYINLITRQRY-CONH2 | Drug Info | Ki = 0.3 nM | [530680] | ||
GWTLNSAGYLLGPHAV-NH2 | Drug Info | Ki = 0.5 nM | [529837] | ||
WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2 | Drug Info | Ki = 51 nM | [530680] | ||
[N-Ac,des-Sar]Gal-B2 | Drug Info | Ki = 1.7 nM | [530680] | ||
[N-Me,des-Sar]Gal-B2 | Drug Info | Ki = 364.5 nM | [530680] | ||
WTLNSAGYLL-CONH2 | Drug Info | Ki = 870 nM | [530680] | ||
(Sar)WTLNSAGYLLGPKK(Lys-stearoyl)K | Drug Info | Ki = 4 nM | [529952] | ||
(Sar)WTLNSAGYLLGPKK(Lys-octanoyl)K | Drug Info | Ki = 0.7 nM | [529952] | ||
(Sar)WTLNSAGYLLGPKK(Lys-decanoyl)K | Drug Info | Ki = 1.3 nM | [529952] | ||
GwTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH2 | Drug Info | Ki = 545 nM | [530680] | ||
(Sar)WTLNSAGYLLGPKK(Lys-lauroyl)K | Drug Info | Ki = 1.4 nM | [529952] | ||
Gal-B5 | Drug Info | Ki = 387 nM | [530680] | ||
(Sar)WTLNSAGYLLGPKK(Lys-MPEG4)K | Drug Info | Ki = 0.5 nM | [529952] | ||
GALANIN | Drug Info | Ki = 0.35 nM | [529789] | ||
References | |||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529837 | J Med Chem. 2008 Dec 25;51(24):8038-47.Design, synthesis, and characterization of high-affinity, systemically-active galanin analogues with potent anticonvulsant activities. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.