Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T09092
|
||||
| Former ID |
TTDR00138
|
||||
| Target Name |
Interleukin-10
|
||||
| Gene Name |
IL10
|
||||
| Synonyms |
CSIF; Cytokine synthesis inhibitory factor; IL-10; IL10
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Endometriosis [ICD9: 617; ICD10: N80] | ||||
| Inflammatory bowel disease; Psoriasis; Rheumatoid arthritis [ICD9: 555, 556, 696, 710-719, 714; ICD10: K50, K51, L40, M00-M25, M05-M06] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Scar tissue [ICD10: L00-L99] | |||||
| Function |
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
|
||||
| BioChemical Class |
Cytokine: interleukin
|
||||
| UniProt ID | |||||
| Sequence |
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | F-8-IL-10 fusion protein | Drug Info | Phase 2 | Endometriosis | [1] |
| Ilodecakin | Drug Info | Phase 2 | Scar tissue | [2] | |
| AM0010 | Drug Info | Phase 1 | Solid tumours | [3] | |
| Modulator | AM0010 | Drug Info | [4] | ||
| F-8-IL-10 fusion protein | Drug Info | [5] | |||
| Ilodecakin | Drug Info | [6] | |||
| Activator | Ankinara | Drug Info | [7] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| FoxO signaling pathway | |||||
| Jak-STAT signaling pathway | |||||
| T cell receptor signaling pathway | |||||
| Intestinal immune network for IgA production | |||||
| Pertussis | |||||
| Leishmaniasis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| Toxoplasmosis | |||||
| Amoebiasis | |||||
| Staphylococcus aureus infection | |||||
| Tuberculosis | |||||
| Epstein-Barr virus infection | |||||
| Asthma | |||||
| Autoimmune thyroid disease | |||||
| Inflammatory bowel disease (IBD) | |||||
| Systemic lupus erythematosus | |||||
| Allograft rejection | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| BCR Signaling Pathway | |||||
| IL2 Signaling Pathway | |||||
| IL4 Signaling Pathway | |||||
| PANTHER Pathway | Interleukin signaling pathway | ||||
| Pathway Interaction Database | Regulation of nuclear SMAD2/3 signaling | ||||
| IL4-mediated signaling events | |||||
| AP-1 transcription factor network | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Cytokines and Inflammatory Response | |||||
| Allograft Rejection | |||||
| References | |||||
| REF 1 | ClinicalTrials.gov (NCT02270632) A Randomized, Placebo-controlled Phase II Clinical Trial to Evaluate the Safety and Efficacy of F8IL10 Dekavil) in Patients With Active RA Receiving MTX. U.S. National Institutes of Health. | ||||
| REF 2 | ClinicalTrials.gov (NCT00984646) Investigation Into the Scar Reduction Potential of Prevascar (Interleukin-10). U.S. National Institutes of Health. | ||||
| REF 3 | ClinicalTrials.gov (NCT02009449) A Phase 1 Study of AM0010 in Patients With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
| REF 4 | Clinical pipeline report, company report or official report of ARMO BioSciences. | ||||
| REF 5 | Preclinical characterization of DEKAVIL (F8-IL10), a novel clinical-stage immunocytokine which inhibits the progression of collagen-induced arthritis. Arthritis Res Ther. 2009;11(5):R142. | ||||
| REF 6 | Ilodecakin. Schering-Plough Corp. IDrugs. 1999 Oct;2(10):1045-58. | ||||
| REF 7 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.