Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T23212
|
||||
| Former ID |
TTDR00283
|
||||
| Target Name |
Monocyte differentiation antigen CD14
|
||||
| Gene Name |
CD14
|
||||
| Synonyms |
Myeloid cell-specific leucine-rich glycoprotein; CD14
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Sepsis [ICD9: 995.91; ICD10: A40, A41] | ||||
| Function |
In concertwith LBP, binds to monomeric lipopolysaccharide and delivers it to the MD-2/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP andTRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.
|
||||
| BioChemical Class |
Leucine rich repeat
|
||||
| UniProt ID | |||||
| Sequence |
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG VSGTLVLLQGARGFA |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| NF-kappa B signaling pathway | |||||
| Phagosome | |||||
| Toll-like receptor signaling pathway | |||||
| Hematopoietic cell lineage | |||||
| Regulation of actin cytoskeleton | |||||
| Pathogenic Escherichia coli infection | |||||
| Salmonella infection | |||||
| Pertussis | |||||
| Legionellosis | |||||
| Amoebiasis | |||||
| Tuberculosis | |||||
| Transcriptional misregulation in cancer | |||||
| NetPath Pathway | FSH Signaling Pathway | ||||
| TNFalpha Signaling Pathway | |||||
| PANTHER Pathway | Toll receptor signaling pathway | ||||
| Pathway Interaction Database | Beta1 integrin cell surface interactions | ||||
| Endogenous TLR signaling | |||||
| Alpha4 beta1 integrin signaling events | |||||
| Reactome | Ligand-dependent caspase activation | ||||
| Toll Like Receptor 4 (TLR4) Cascade | |||||
| Mal cascade initiated on plasma membrane | |||||
| MyD88-independent TLR3/TLR4 cascade | |||||
| TLR2 Cascade | |||||
| TRIF-mediated programmed cell death | |||||
| MyD88 deficiency (TLR2/4) | |||||
| IRAK4 deficiency (TLR2/4) | |||||
| Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon | |||||
| IKK complex recruitment mediated by RIP1 | |||||
| TRAF6 mediated induction of TAK1 complex | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| Regulation of Actin Cytoskeleton | |||||
| MAPK Signaling Pathway | |||||
| Vitamin D Receptor Pathway | |||||
| Toll-Like Receptors Cascades | |||||
| Mal cascade initiated on plasma membrane | |||||
| MyD88-independent cascade | |||||
| Pathogenic Escherichia coli infection | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.