Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T28076
|
||||
Former ID |
TTDI01961
|
||||
Target Name |
Fibroblast growth factor-4
|
||||
Gene Name |
FGF4
|
||||
Synonyms |
Fibroblast growth factor 4; HBGF4; HST; HST1; HSTF1; Heparin secretorytransforming protein 1; Heparinbinding growth factor 4; Transforming protein KS3; FGF4
|
||||
Target Type |
Successful
|
||||
Disease | Angina pectoris [ICD9: 413; ICD10: I20] | ||||
Heart disease [ICD9: 390-429; ICD10: I00-I52] | |||||
Interstitial cystitis; Painful bladder syndrome [ICD9: 595.1,338,780; ICD10: N30.1, G89, R52] | |||||
Function |
Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
|
||||
BioChemical Class |
Heparin-binding growth factors family
|
||||
UniProt ID | |||||
Sequence |
MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA LSKNGKTKKGNRVSPTMKVTHFLPRL |
||||
Drugs and Mode of Action | |||||
Drug(s) | Pentosan Polysulfate | Drug Info | Approved | Interstitial cystitis; Painful bladder syndrome | [1] |
Ad5FGF-4 | Drug Info | Phase 3 | Angina pectoris | [2] | |
Alferminogene tadenovec | Drug Info | Phase 3 | Heart disease | [3] | |
Modulator | Ad5FGF-4 | Drug Info | [4] | ||
Alferminogene tadenovec | Drug Info | [3] | |||
Pentosan Polysulfate | Drug Info | [5] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | MAPK signaling pathway | ||||
Ras signaling pathway | |||||
Rap1 signaling pathway | |||||
PI3K-Akt signaling pathway | |||||
Regulation of actin cytoskeleton | |||||
Pathways in cancer | |||||
Melanoma | |||||
PANTHER Pathway | FGF signaling pathway | ||||
Pathway Interaction Database | Regulation of nuclear beta catenin signaling and target gene transcription | ||||
FGF signaling pathway | |||||
Reactome | PI3K Cascade | ||||
PIP3 activates AKT signaling | |||||
FGFR4 ligand binding and activation | |||||
FGFR3c ligand binding and activation | |||||
FGFR2c ligand binding and activation | |||||
FGFR3 mutant receptor activation | |||||
Activated point mutants of FGFR2 | |||||
Constitutive Signaling by Aberrant PI3K in Cancer | |||||
FGFR1 | |||||
Phospholipase C-mediated cascade | |||||
Phospholipase C-mediated cascade | |||||
Phospholipase C-mediated cascade | |||||
FGFR1 | |||||
FGFR1 | |||||
FRS-mediated FGFR1 signaling | |||||
FGFR2 | |||||
FGFR2 | |||||
FRS-mediated FGFR2 signaling | |||||
FGFR3 | |||||
FRS-mediated FGFR3 signaling | |||||
FGFR3 | |||||
FRS-mediated FGFR4 signaling | |||||
FGFR4 | |||||
FGFR4 | |||||
Negative regulation of FGFR1 signaling | |||||
Negative regulation of FGFR2 signaling | |||||
Negative regulation of FGFR3 signaling | |||||
Negative regulation of FGFR4 signaling | |||||
RAF/MAP kinase cascade | |||||
WikiPathways | Regulation of Actin Cytoskeleton | ||||
MAPK Signaling Pathway | |||||
Differentiation Pathway | |||||
Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) | |||||
PIP3 activates AKT signaling | |||||
Signaling by FGFR | |||||
References | |||||
REF 1 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 020193. | ||||
REF 2 | ClinicalTrials.gov (NCT01550614) Efficacy and Safety of Ad5FGF-4 for Myocardial Ischemia in Patients With Stable Angina Due to Coronary Artery Disease. U.S. National Institutes of Health. | ||||
REF 3 | Alferminogene tadenovec, an angiogenic FGF4 gene therapy for coronary artery disease. IDrugs. 2008 Apr;11(4):283-93. | ||||
REF 4 | Angiogenic gene therapy with adenovirus 5 fibroblast growth factor-4 (Ad5FGF-4): a new option for the treatment of coronary artery disease. Am J Cardiol. 2003 Nov 7;92(9B):24N-31N. | ||||
REF 5 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.