Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T53472
|
||||
Former ID |
TTDI02107
|
||||
Target Name |
Killer cell immunoglobulin-like receptor 2DL3
|
||||
Gene Name |
KIR2DL3
|
||||
Synonyms |
CD158 antigenlike family member B2; CD158b2; KIR023GB; Killer inhibitory receptor cl 23; MHC class I NK cell receptor; NKAT2; NKAT2a; NKAT2b; Natural killerassociated transcript 2; p58 NK receptor CL6; p58 natural killer cell receptor clone CL6; p58.2 MHC classIspecific NK receptor; KIR2DL3
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | ||||
Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
Function |
Receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3 and HLA-Cw7). Inhibits the activity of NK cells thus preventing cell lysis.
|
||||
BioChemical Class |
Immunoglobulin
|
||||
UniProt ID | |||||
Sequence |
MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
References | |||||
Ref 524057 | ClinicalTrials.gov (NCT01687387) Efficacy Study of Anti-KIR Monoclonal Antibody as Maintenance Treatment in Acute Myeloid Leukemia (EFFIKIR). U.S. National Institutes of Health. | ||||
Ref 530228 | Preclinical characterization of 1-7F9, a novel human anti-KIR receptor therapeutic antibody that augments natural killer-mediated killing of tumor cells. Blood. 2009 Sep 24;114(13):2667-77. | ||||
Ref 530238 | Genetic and antibody-mediated reprogramming of natural killer cell missing-self recognition in vivo. Proc Natl Acad Sci U S A. 2009 Aug 4;106(31):12879-84. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.