Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T56308
|
||||
| Former ID |
TTDR00519
|
||||
| Target Name |
Interleukin-11
|
||||
| Gene Name |
IL11
|
||||
| Synonyms |
AGIF; Adipogenesis inhibitory factor; IL-11; Oprelvekin; IL11
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Thrombocytopenia [ICD9: 287.3, 287.4, 287.5; ICD10: D69.6, P61.0] | ||||
| Function |
Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production (PubMed:2145578). Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation (PubMed:12919066). Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.
|
||||
| BioChemical Class |
Cytokine: interleukin
|
||||
| UniProt ID | |||||
| Sequence |
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG LHLTLDWAVRGLLLLKTRL |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| Jak-STAT signaling pathway | |||||
| Hematopoietic cell lineage | |||||
| Rheumatoid arthritis | |||||
| NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
| PANTHER Pathway | Interleukin signaling pathway | ||||
| WikiPathways | Cytokines and Inflammatory Response | ||||
| Differentiation Pathway | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Interleukin-11 Signaling Pathway | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.