Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T76630
|
||||
| Former ID |
TTDS00096
|
||||
| Target Name |
CAMPATH-1 antigen
|
||||
| Gene Name |
CD52
|
||||
| Synonyms |
CD52 antigen; CDW52; Cambridge pathology 1 antigen; Epididymal secretory protein E5; CD52
|
||||
| Target Type |
Successful
|
||||
| Disease | Multiple scierosis; Chronic lymphocytic leukaemia [ICD9:340; ICD10: G35, C91] | ||||
| Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
| Function |
May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
|
||||
| BioChemical Class |
Transmembrane protein
|
||||
| UniProt ID | |||||
| Sequence |
MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
S |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Alemtuzumab | Drug Info | Approved | Multiple scierosis; Chronic lymphocytic leukaemia | [1], [2], [3] |
| GZ402668 | Drug Info | Phase 1 | Multiple scierosis | [4] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| References | |||||
| REF 1 | 2013 FDA drug approvals. Nat Rev Drug Discov. 2014 Feb;13(2):85-9. | ||||
| REF 2 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | ||||
| REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6770). | ||||
| REF 4 | ClinicalTrials.gov (NCT02282826) A First-in-human, Single Ascending Dose Study of GZ402668 in Patients With Progressive Multiple Sclerosis. U.S. National Institutes of Health. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.