Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T95899
|
||||
Former ID |
TTDC00142
|
||||
Target Name |
mRNA of Clusterin
|
||||
Gene Name |
CLU
|
||||
Synonyms |
Apo-J; Apolipoprotein J; CLI; Complement cytolysis inhibitor; Complement-associated protein SP-40,40; NA1/NA2; TRPM-2; Testosterone-repressed prostate message 2; CLU
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Prostate cancer; Breast cancer; Lung cancer [ICD9: 140-229, 162, 174, 175, 185; ICD10: C00-C96, C33-C34, C50, C61] | ||||
Function |
Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress- induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells againstapoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation.
|
||||
BioChemical Class |
Target of antisense drug
|
||||
Target Validation |
T95899
|
||||
UniProt ID | |||||
Sequence |
MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLI
EKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT CMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHF SRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNF HAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKD QCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLE QLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP VEVSRKNPKFMETVAEKALQEYRKKHREE |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
FSH Signaling Pathway | |||||
PANTHER Pathway | CCKR signaling map ST | ||||
Pathway Interaction Database | Validated targets of C-MYC transcriptional repression | ||||
Reactome | Platelet degranulation | ||||
WikiPathways | Complement and Coagulation Cascades | ||||
References | |||||
Ref 536937 | Custirsen (OGX-011): a second-generation antisense inhibitor of clusterin for the treatment of cancer. Expert Opin Investig Drugs. 2008 Dec;17(12):1955-62. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.