Target Information

Target General Infomation
Target ID
T02532
Former ID
TTDS00368
Target Name
T-cell surface antigen CD2
Gene Name
CD2
Synonyms
Erythrocyte receptor; LFA-2; LFA-3 receptor; Rosette receptor; T-cell surface antigen T11/Leu-5; CD2
Target Type
Clinical Trial
Disease Cancer; Psoriasis [ICD9: 140-229, 696; ICD10: L40]
Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86]
Function
CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T- cells, the cytoplasmic domain is implicated in the signaling function.
BioChemical Class
Transmembrane protein
UniProt ID
P06729
Sequence
MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK
IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ
RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP
GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
Drugs and Mode of Action
Drug(s) Siplizumab Drug Info Phase 2 Lymphoma [531024]
Siplizumab Drug Info Discontinued in Phase 2 Cancer; Psoriasis [536054]
Inhibitor Alpha-D-Mannose Drug Info [551393]
Cyclo(1,10)EIYDPGDDIK Drug Info [529900]
Cyclo(1,10)H-EIYDPGDDIK-OH Drug Info [529900]
Cyclo(1,11)H-ESIYDPGDDIK-OH Drug Info [529900]
Cyclo(1,12)PenIYDTKGKNVLC-OH Drug Info [527770]
Pen(Acm)AQFRKEKETFC(Acm)-OH Drug Info [527770]
Pathways
KEGG Pathway Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
NetPath Pathway TCR Signaling Pathway
IL2 Signaling Pathway
Reactome Cell surface interactions at the vascular wall
WikiPathways Cell surface interactions at the vascular wall
References
Ref 531024Safety profile of intravenous and subcutaneous siplizumab, an anti-CD2 monoclonal antibody, for the treatment of plaque psoriasis: results of two randomized, double-blind, placebo-controlled studies.Int J Dermatol. 2010 Jul;49(7):818-28.
Ref 536054Emerging drugs for moderate-to-severe psoriasis. Expert Opin Emerg Drugs. 2005 Feb;10(1):35-52.
Ref 527770J Med Chem. 2005 Oct 6;48(20):6236-49.Structure-activity studies of peptides from the "hot-spot" region of human CD2 protein: development of peptides for immunomodulation.
Ref 529900J Med Chem. 2009 Feb 12;52(3):726-36.Design of beta-hairpin peptides for modulation of cell adhesion by beta-turn constraint.
Ref 536054Emerging drugs for moderate-to-severe psoriasis. Expert Opin Emerg Drugs. 2005 Feb;10(1):35-52.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.