Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T16650
|
||||
| Former ID |
TTDR00389
|
||||
| Target Name |
Glycoprotein hormones alpha chain
|
||||
| Gene Name |
CGA
|
||||
| Synonyms |
CG-alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin alpha subunit; FSH-alpha; Follicle-stimulating hormone alpha chain; Follitropin alpha chain; LSH-alpha; Luteinizing hormone alpha chain; Lutropin alpha chain; TSH-alpha; Thyroid-stimulating hormone alpha chain; Thyrotropin alpha chain; CGA
|
||||
| Target Type |
Research
|
||||
| BioChemical Class |
Glycoprotein hormones
|
||||
| UniProt ID | |||||
| Sequence |
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| GnRH signaling pathway | |||||
| Ovarian steroidogenesis | |||||
| Prolactin signaling pathway | |||||
| Thyroid hormone synthesis | |||||
| Autoimmune thyroid disease | |||||
| PANTHER Pathway | Thyrotropin-releasing hormone receptor signaling pathway | ||||
| Pathway Interaction Database | Glucocorticoid receptor regulatory network | ||||
| PathWhiz Pathway | Intracellular Signalling Through FSH Receptor and Follicle Stimulating Hormone | ||||
| Intracellular Signalling Through LHCGR Receptor and Luteinizing Hormone/Choriogonadotropin | |||||
| Reactome | Androgen biosynthesis | ||||
| Thyroxine biosynthesis | |||||
| Hormone ligand-binding receptors | |||||
| G alpha (s) signalling events | |||||
| WikiPathways | Metabolism of steroid hormones and vitamin D | ||||
| Metabolism of amino acids and derivatives | |||||
| Peptide hormone biosynthesis | |||||
| FSH signaling pathway | |||||
| TSH signaling pathway | |||||
| Thyroxine (Thyroid Hormone) Production | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.