Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T35232
|
||||
Former ID |
TTDNC00584
|
||||
Target Name |
Recombinant human interleukin-7
|
||||
Gene Name |
IL7
|
||||
Synonyms |
Interleukin7; IL7
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Multiple scierosis [ICD9: 340; ICD10: G35] | ||||
Function |
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
|
||||
BioChemical Class |
Interleukin receptor family
|
||||
UniProt ID | |||||
Sequence |
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCL
NNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQ VKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
PI3K-Akt signaling pathway | |||||
Jak-STAT signaling pathway | |||||
Hematopoietic cell lineage | |||||
NetPath Pathway | TNFalpha Signaling Pathway | ||||
PANTHER Pathway | Interleukin signaling pathway | ||||
Reactome | Interleukin-7 signaling | ||||
WikiPathways | Cytokines and Inflammatory Response | ||||
Interleukin-7 signaling | |||||
IL-7 Signaling Pathway | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.