Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T37046
|
||||
| Former ID |
TTDS00494
|
||||
| Target Name |
Biliverdin reductase A
|
||||
| Gene Name |
BLVRA
|
||||
| Synonyms |
BLVR; BVR; BVR A; Biliverdin-IX alpha-reductase; BLVRA
|
||||
| Target Type |
Successful
|
||||
| Disease | Primary biliary cirrhosis [ICD9: 571.6; ICD10: K74.3] | ||||
| Function |
Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.
|
||||
| BioChemical Class |
Oxidoreductases acting on CH-CH group of donors
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.3.1.24
|
||||
| Sequence |
MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLE
DALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKV LHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLF GELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLEN VPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ursodeoxycholic acid | Drug Info | Approved | Primary biliary cirrhosis | [1], [2] |
| Inhibitor | Nicotinamide-Adenine-Dinucleotide | Drug Info | [3] | ||
| Activator | Ursodeoxycholic acid | Drug Info | [4], [5] | ||
| Pathways | |||||
| BioCyc Pathway | Heme degradation | ||||
| KEGG Pathway | Porphyrin and chlorophyll metabolism | ||||
| PathWhiz Pathway | Porphyrin Metabolism | ||||
| References | |||||
| REF 1 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7104). | ||||
| REF 2 | Drug information of Ursodeoxycholic acid, 2008. eduDrugs. | ||||
| REF 3 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 4 | Influence of ursodeoxycholic acid on the mortality and malignancy associated with primary biliary cirrhosis: a population-based cohort study. Hepatology. 2007 Oct;46(4):1131-7. | ||||
| REF 5 | Role of vitamin C transporters and biliverdin reductase in the dual pro-oxidant and anti-oxidant effect of biliary compounds on the placental-fetal unit in cholestasis during pregnancy. Toxicol Appl Pharmacol. 2008 Oct 15;232(2):327-36. Epub 2008 Jul 23. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.