Target Information

Target General Infomation
Target ID
T78393
Former ID
TTDR01372
Target Name
mRNA of human Macrophage migration inhibitory factor
Gene Name
MIF
Synonyms
GIF (mRNA); Glycosylationinhibiting factor (mRNA); Ldopachrome isomerase (mRNA); Ldopachrome tautomerase (mRNA); MIF (mRNA); Macrophage migration inhibitory factor (mRNA); Phenylpyruvate tautomerase (mRNA); MIF
Target Type
Research
Function
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti- inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. Itis not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
BioChemical Class
Intramolecular oxidoreductases
Target Validation
T78393
UniProt ID
P14174
EC Number
EC 5.3.3.12
Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Inhibitor 1-(2-chlorophenyl)-3-(pyridin-2-yl)thiourea Drug Info [551226]
1-phenyl-3-(1,3,4-thiadiazol-2-yl)thiourea Drug Info [551226]
2-(4-hydroxystyryl)quinolin-8-ol Drug Info [529867]
3,3,3-tris(4-chlorophenyl)propanoic acid Drug Info [527973]
3-(1H-pyrazol-3-yl)benzoic acid Drug Info [529867]
3-acetyl-7-hydroxy-2H-chromen-2-one Drug Info [529867]
3-benzyl-5-fluorobenzo[d]oxazol-2(3H)-one Drug Info [531118]
3-benzyl-5-methylbenzo[d]oxazol-2(3H)-one Drug Info [531118]
3-benzyl-6-methylbenzo[d]oxazol-2(3H)-one Drug Info [531118]
4-((pyridin-4-ylthio)methyl)benzene-1,2-diol Drug Info [527973]
4-(4-benzyl-1H-1,2,3-triazol-1-yl)phenol Drug Info [531232]
4-iodo-6-phenylpyrimidine Drug Info [531118]
6-phenylpyridazin-3-yl thiophene-2-carboxylate Drug Info [551226]
7-hydroxy-3-phenyl-2H-chromen-2-one Drug Info [529867]
Benzofuran-2-yl(indolin-1-yl)methanone Drug Info [529867]
Ethyl 7-hydroxy-2-oxo-2H-chromene-3-carboxylate Drug Info [529867]
N-(2-bromobenzoyloxy)-4-chlorobenzamide Drug Info [551226]
S-benzo[d]oxazol-2-yl O-butyl carbonothioate Drug Info [551226]
Pathways
KEGG Pathway Tyrosine metabolism
Phenylalanine metabolism
PathWhiz Pathway Tyrosine Metabolism
WikiPathways Spinal Cord Injury
Adipogenesis
References
Ref 527973J Med Chem. 2006 Jan 26;49(2):523-33.Classification of chemical compounds by protein-compound docking for use in designing a focused library.
Ref 529867J Med Chem. 2009 Jan 22;52(2):416-24.Discovery of human macrophage migration inhibitory factor (MIF)-CD74 antagonists via virtual screening.
Ref 531118Bioorg Med Chem Lett. 2010 Oct 1;20(19):5811-4. Epub 2010 Aug 3.Optimization of N-benzyl-benzoxazol-2-ones as receptor antagonists of macrophage migration inhibitory factor (MIF).
Ref 531232Bioorg Med Chem Lett. 2010 Dec 1;20(23):7033-6. Epub 2010 Sep 29.Receptor agonists of macrophage migration inhibitory factor.
Ref 549639US patent application no. 6,268,151, Antisense modulation of macrophage migration inhibitory factor expression.
Ref 551226An integrative in silico methodology for the identification of modulators of macrophage migration inhibitory factor (MIF) tautomerase activity. Bioorg Med Chem. 2010 Jul 15;18(14):5425-40. doi: 10.1016/j.bmc.2010.05.010. Epub 2010 May 13.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.