Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T81892
|
||||
Former ID |
TTDC00280
|
||||
Target Name |
mRNA of Inhibitor of apoptosis protein
|
||||
Gene Name |
XIAP
|
||||
Synonyms |
Baculoviral IAP repeat-containing protein 4; HILP; IAP-like protein; Inhibitor of apoptosis protein 3; X-linked IAP; X-linked inhibitor of apoptosis; X-linked inhibitor of apoptosis protein; XIAP
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Function |
Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, copper homeostasis, mitogenic kinase signaling, cell proliferation, as well as cell invasion and metastasis. Acts as a direct caspase inhibitor. Directly bind to the active site pocket of CASP3 and CASP7 and obstructs substrate entry. Inactivates CASP9 by keeping it in a monomeric, inactive state. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and the target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, CASP3, CASP7, CASP8, CASP9, MAP3K2/MEKK2, DIABLO/SMAC, AIFM1, CCS and BIRC5/survivin. Ubiquitinion of CCS leads to enhancement of its chaperone activity toward its physiologic target, SOD1, rather than proteasomal degradation. Ubiquitinion of MAP3K2/MEKK2 and AIFM1 does not lead to proteasomal degradation. Plays a role in copper homeostasis by ubiquitinationg COMMD1 and promoting its proteasomal degradation. Can also function as E3 ubiquitin-protein ligase of the NEDD8 conjugation pathway, targeting effector caspases for neddylation and inactivation. Regulates the BMP signaling pathway and the SMAD and MAP3K7/TAK1 dependent pathways leading to NF-kappa-B and JNK activation. Acts as an important regulator of innate immune signaling via regulation of Nodlike receptors (NLRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8. Acts as a positive regulator of Wnt signaling and ubiquitinates TLE1, TLE2, TLE3, TLE4 and AES. Ubiquitination of TLE3 results in inhibition of its interaction with TCF7L2/TCF4 thereby allowing efficient recruitment and binding of the transcriptional coactivator beta- catenin to TCF7L2/TCF4 that is required to initiate a Wnt-specific transcriptional program.
|
||||
BioChemical Class |
Target of antisense drug
|
||||
Target Validation |
T81892
|
||||
UniProt ID | |||||
EC Number |
EC 6.3.2.-
|
||||
Sequence |
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK CPMCYTVITFKQKIFMS |
||||
Drugs and Mode of Action | |||||
Pathways | |||||
KEGG Pathway | NF-kappa B signaling pathway | ||||
Ubiquitin mediated proteolysis | |||||
Apoptosis | |||||
Focal adhesion | |||||
Toxoplasmosis | |||||
HTLV-I infection | |||||
Pathways in cancer | |||||
Small cell lung cancer | |||||
PANTHER Pathway | Apoptosis signaling pathway | ||||
Pathway Interaction Database | p75(NTR)-mediated signaling | ||||
BMP receptor signaling | |||||
Caspase Cascade in Apoptosis | |||||
TGF-beta receptor signaling | |||||
Reactome | SMAC binds to IAPs | ||||
caspase complexes | |||||
Deactivation of the beta-catenin transactivating complex | |||||
RIPK1-mediated regulated necrosis | |||||
Regulation of TNFR1 signaling | |||||
TNFR1-induced NFkappaB signaling pathway | |||||
Regulation of necroptotic cell death | |||||
WikiPathways | Copper homeostasis | ||||
Focal Adhesion | |||||
Apoptosis | |||||
Intrinsic Pathway for Apoptosis | |||||
Apoptosis Modulation and Signaling | |||||
NOD pathway | |||||
References | |||||
Ref 527061 | J Med Chem. 2004 May 6;47(10):2430-40.Discovery of embelin as a cell-permeable, small-molecular weight inhibitor of XIAP through structure-based computational screening of a traditional herbal medicine three-dimensional structure database. | ||||
Ref 529155 | IAP antagonists induce autoubiquitination of c-IAPs, NF-kappaB activation, and TNFalpha-dependent apoptosis. Cell. 2007 Nov 16;131(4):669-81. | ||||
Ref 529809 | J Med Chem. 2008 Dec 11;51(23):7352-5.Design, synthesis, and evaluation of tricyclic, conformationally constrained small-molecule mimetics of second mitochondria-derived activator of caspases. | ||||
Ref 531078 | J Med Chem. 2010 Sep 9;53(17):6361-7.Nonpeptidic and potent small-molecule inhibitors of cIAP-1/2 and XIAP proteins. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.