Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T93903
|
||||
| Former ID |
TTDR01006
|
||||
| Target Name |
Caspase-9
|
||||
| Gene Name |
CASP9
|
||||
| Synonyms |
APAF-3; Apoptotic protease Mch-6; Apoptotic protease activating factor 3; CASP-9; ICE-LAP6; ICE-like apoptotic protease 6; CASP9
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Cystic fibrosis [ICD9: 277; ICD10: E84] | |||||
| Function |
Involved in the activation cascade of caspases responsible for apoptosis execution. Binding of caspase-9 to apaf- 1 leads to activation of the protease which then cleaves and activates caspase-3. Proteolytically cleaves poly(adp-ribose) polymerase (parp).
|
||||
| BioChemical Class |
Peptidase
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.22.62
|
||||
| Sequence |
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS |
||||
| Structure |
1JXQ; 1NW9; 2AR9; 3D9T; 3V3K; 3YGS; 4RHW
|
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| KEGG Pathway | p53 signaling pathway | ||||
| PI3K-Akt signaling pathway | |||||
| Apoptosis | |||||
| VEGF signaling pathway | |||||
| Thyroid hormone signaling pathway | |||||
| Alzheimer' | |||||
| s disease | |||||
| Parkinson' | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Huntington' | |||||
| Legionellosis | |||||
| Toxoplasmosis | |||||
| Tuberculosis | |||||
| Hepatitis B | |||||
| Influenza A | |||||
| Pathways in cancer | |||||
| Colorectal cancer | |||||
| Pancreatic cancer | |||||
| Endometrial cancer | |||||
| Prostate cancer | |||||
| Small cell lung cancer | |||||
| Non-small cell lung cancer | |||||
| Viral myocarditis | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| FSH Signaling Pathway | |||||
| TCR Signaling Pathway | |||||
| PANTHER Pathway | Angiogenesis | ||||
| Apoptosis signaling pathway | |||||
| FAS signaling pathway | |||||
| PI3 kinase pathway | |||||
| VEGF signaling pathway | |||||
| Pathway Interaction Database | p75(NTR)-mediated signaling | ||||
| Negative effector of Fas and TNF-alpha | |||||
| Caspase Cascade in Apoptosis | |||||
| Class I PI3K signaling events mediated by Akt | |||||
| Reactome | SMAC binds to IAPs | ||||
| caspase complexes | |||||
| NOD1/2 Signaling Pathway | |||||
| AKT phosphorylates targets in the cytosol | |||||
| Constitutive Signaling by AKT1 E17K in Cancer | |||||
| WikiPathways | DNA Damage Response | ||||
| Apoptosis Modulation by HSP70 | |||||
| FAS pathway and Stress induction of HSP regulation | |||||
| PIP3 activates AKT signaling | |||||
| Apoptosis | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Parkinsons Disease Pathway | |||||
| Corticotropin-releasing hormone | |||||
| Allograft Rejection | |||||
| AGE/RAGE pathway | |||||
| TNF alpha Signaling Pathway | |||||
| Prostate Cancer | |||||
| Alzheimers Disease | |||||
| Integrated Breast Cancer Pathway | |||||
| Integrated Cancer pathway | |||||
| Regulation of Apoptosis | |||||
| Intrinsic Pathway for Apoptosis | |||||
| Apoptosis Modulation and Signaling | |||||
| miRNA Regulation of DNA Damage Response | |||||
| NOD pathway | |||||
| References | |||||
| Ref 526075 | Potent and selective nonpeptide inhibitors of caspases 3 and 7. J Med Chem. 2001 Jun 7;44(12):2015-26. | ||||
| Ref 532688 | Glionitrin A, a new diketopiperazine disulfide, activates ATM-ATR-Chk1/2 via 53BP1 phosphorylation in DU145 cells and shows antitumor effect in xenograft model. Biol Pharm Bull. 2014;37(3):378-86. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.