Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T25847
|
||||
| Former ID |
TTDS00417
|
||||
| Target Name |
Peptidyl-prolyl cis-trans isomerase B
|
||||
| Gene Name |
PPIB
|
||||
| Synonyms |
CYP-S1; CYPB; Cyclophilin B; PPIase; Rotamase; S-cyclophilin; SCYLP; PPIB
|
||||
| Target Type |
Successful
|
||||
| Disease | Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | ||||
| Function |
PPIases accelerate the foldingof proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
|
||||
| BioChemical Class |
Cis-trans-isomerases
|
||||
| UniProt ID | |||||
| EC Number |
EC 5.2.1.8
|
||||
| Sequence |
MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | L-Proline | Drug Info | Approved | Dietary shortage | [1], [2] |
| Inhibitor | 1,4-Dithiothreitol | Drug Info | [3] | ||
| Binder | L-Proline | Drug Info | [1] | ||
| Pathways | |||||
| Pathway Interaction Database | Syndecan-1-mediated signaling events | ||||
| PathWhiz Pathway | Retinol Metabolism | ||||
| Reactome | Collagen biosynthesis and modifying enzymes | ||||
| WikiPathways | Collagen biosynthesis and modifying enzymes | ||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| miR-targeted genes in leukocytes - TarBase | |||||
| miR-targeted genes in epithelium - TarBase | |||||
| References | |||||
| REF 1 | Escherichia coli cyclophilin B binds a highly distorted form of trans-prolyl peptide isomer. Eur J Biochem. 2004 Sep;271(18):3794-803. | ||||
| REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3314). | ||||
| REF 3 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.