Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T68834
|
||||
| Former ID |
TTDI03427
|
||||
| Target Name |
OXE receptor
|
||||
| Gene Name |
OXER1
|
||||
| Synonyms |
OXER1
|
||||
| Target Type |
Research
|
||||
| UniProt ID | |||||
| Sequence |
MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPS
FSPSPSSAPSAFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIH TRPWTSNTVFLVSLVAADFLLISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASV VFLTAIALNRYLKVVQPHHVLSRASVGAAARVAGGLWVGILLLNGHLLLSTFSGPSCLSY RVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIRNRGLGGQAGPQRAMRVLAMV VAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVLDPVLYCFSSP NFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS SQG |
||||
| Antagonist | 5-(6-chloro-2-hexyl-1H-indol-1-yl)-5-oxo-valeric acid | Drug Info | [1] | ||
| 5-oxo-12-HETE | Drug Info | [2] | |||
| Agonist | 5-oxo-15-HETE | Drug Info | [3] | ||
| 5-oxo-20-HETE | Drug Info | [3] | |||
| 5-oxo-C20:3 | Drug Info | [4] | |||
| 5-oxo-ETE | Drug Info | [5] | |||
| 5-oxo-ODE | Drug Info | [6] | |||
| 5S-HETE | Drug Info | [7] | |||
| 5S-HPETE | Drug Info | [7] | |||
| [3H]5-oxo-ETE | Drug Info | [8] | |||
| Modulator (allosteric modulator) | Gue1654 | Drug Info | [9] | ||
| References | |||||
| REF 1 | 5-Oxo-ETE receptor antagonists. J Med Chem. 2013 May 9;56(9):3725-32. | ||||
| REF 2 | Biological inactivation of 5-oxo-6,8,11,14-eicosatetraenoic acid by human platelets. Blood. 1999 Feb 1;93(3):1086-96. | ||||
| REF 3 | Metabolism and biologic effects of 5-oxoeicosanoids on human neutrophils. J Immunol. 1996 Jan 1;156(1):336-42. | ||||
| REF 4 | Structural requirements for activation of the 5-oxo-6E,8Z, 11Z,14Z-eicosatetraenoic acid (5-oxo-ETE) receptor: identification of a mead acid metabolite with potent agonist activity. J Pharmacol Exp Ther. 2008 May;325(2):698-707. | ||||
| REF 5 | Metabolism of 5(S)-hydroxy-6,8,11,14-eicosatetraenoic acid and other 5(S)-hydroxyeicosanoids by a specific dehydrogenase in human polymorphonuclear leukocytes. J Biol Chem. 1992 Sep 25;267(27):19233-41. | ||||
| REF 6 | Human neutrophils convert the sebum-derived polyunsaturated fatty acid Sebaleic acid to a potent granulocyte chemoattractant. J Biol Chem. 2008 Apr 25;283(17):11234-43. | ||||
| REF 7 | TG1019/OXE, a Galpha(i/o)-protein-coupled receptor, mediates 5-oxo-eicosatetraenoic acid-induced chemotaxis. Biochem Biophys Res Commun. 2005 Sep 9;334(4):987-95. | ||||
| REF 8 | Receptors for the 5-oxo class of eicosanoids in neutrophils. J Biol Chem. 1998 Dec 4;273(49):32535-41. | ||||
| REF 9 | A biased ligand for OXE-R uncouples Galpha and Gbetagamma signaling within a heterotrimer. Nat Chem Biol. 2012 Jul;8(7):631-8. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.