Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T97713
|
||||
Former ID |
TTDS00401
|
||||
Target Name |
Inosine-5'-monophosphate dehydrogenase 1
|
||||
Gene Name |
PPAT
|
||||
Synonyms |
IMP dehydrogenase 1; IMPD 1; IMPD1; IMPDH-I; IMPDH1; PPAT
|
||||
Target Type |
Successful
|
||||
Disease | Organ transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | ||||
BioChemical Class |
Short-chain dehydrogenases reductases
|
||||
Target Validation |
T97713
|
||||
UniProt ID | |||||
EC Number |
EC 1.1.1.205
|
||||
Sequence |
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT
FKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFL SIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQP NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKE KKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW |
||||
Structure |
1JCN
|
||||
Drugs and Mode of Action | |||||
Drug(s) | Azathioprine | Drug Info | Approved | Organ transplant rejection | [1], [2] |
Inhibitor | 6-Chloropurine Riboside, 5'-Monophosphate | Drug Info | [3] | ||
Azathioprine | Drug Info | [4], [5] | |||
Mycophenolic bis(sulfonamide) | Drug Info | [6] | |||
Mycophenolic hydroxamic acid | Drug Info | [7] | |||
Tiazofurin adenine dinucleotide | Drug Info | [8] | |||
Pathways | |||||
BioCyc Pathway | Purine nucleotides degradation | ||||
Urate biosynthesis/inosine 5' | |||||
-phosphate degradation | |||||
Guanosine nucleotides de novo biosynthesis | |||||
Superpathway of purine nucleotide salvage | |||||
Purine nucleotides de novo biosynthesis | |||||
Guanosine ribonucleotides de novo biosynthesis | |||||
KEGG Pathway | Purine metabolism | ||||
Drug metabolism - other enzymes | |||||
Metabolic pathways | |||||
PathWhiz Pathway | Purine Metabolism | ||||
Reactome | Purine ribonucleoside monophosphate biosynthesis | ||||
WikiPathways | Nucleotide Metabolism | ||||
References | |||||
REF 1 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7120). | ||||
REF 3 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 4 | Immunosuppressive drugs and renal transplantation. G Ital Nefrol. 2005 Nov-Dec;22 Suppl 33:S76-9. | ||||
REF 5 | IMPDH activity in thiopurine-treated patients with inflammatory bowel disease - relation to TPMT activity and metabolite concentrations. Br J Clin Pharmacol. 2008 Jan;65(1):69-77. Epub 2007 Jul 27. | ||||
REF 6 | Bioorg Med Chem. 2008 Aug 1;16(15):7462-9. Epub 2008 Jun 10.Bis(sulfonamide) isosters of mycophenolic adenine dinucleotide analogues: inhibition of inosine monophosphate dehydrogenase. | ||||
REF 7 | Bioorg Med Chem. 2010 Nov 15;18(22):8106-11. Epub 2010 Sep 18.Structure-activity relationships for inhibition of inosine monophosphate dehydrogenase and differentiation induction of K562 cells amongthe mycophenolic acid derivatives. | ||||
REF 8 | J Med Chem. 2007 Dec 27;50(26):6685-91. Epub 2007 Nov 27.Dual inhibitors of inosine monophosphate dehydrogenase and histone deacetylases for cancer treatment. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.